Dhiyanoiseasmr

asmr_byluisa

Subs(1870) Views(103299)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Tuning Fork or Singing Bowl? ^.^ Brain Vibrations

Hi! My name is Luisa. Welcome to my world! ^.^ My heart and mind are complete living in art and culture [ASMR included] ^.^ _____________ Find me on: My website | https://asmrbyluisa.com Twitch | https://www.twitch.tv/luisadpatricio Instagram | https://www

Dhiyanoiseasmr

ASMR | Pop Rocks * Relaxing Sounds Before Sleep

Hi! My name is Luisa. Welcome to my world! ^.^ My heart and mind are complete living in art and culture [ASMR included] ^.^ _____________ Find me on: My website | https://asmrbyluisa.com Twitch | https://www.twitch.tv/luisadpatricio Instagram | https://www

Dhiyanoiseasmr

ASMR | Follow/Not follow the Light * Making you Fall Asleep

Hi! My name is Luisa. Welcome to my world! ^.^ My heart and mind are complete living in art and culture [ASMR included] ^.^ _____________ Find me on: My website | https://asmrbyluisa.com Twitch | https://www.twitch.tv/luisadpatricio Instagram | https://www

Dhiyanoiseasmr

Starry Feet ASMR

Subs(2050) Views(145857)

Last Update (07/2021)

Dhiyanoiseasmr

Feet ASMR on the carpet, fabric sounds :-)

For Patreon (early access + exclusives) and donations read below! ^^ My other ASMR channel (classic and weird stuff): StarLady ASMR https://www.youtube.com/channel/UCrjYB4DPyNAMM1TNlPb8R8g Please subscribe if you like my content, hit the bell, like, lea

Dhiyanoiseasmr

11 HOURS OF FEET ASMR (megamix)

Do the list of timestamps if you're brave enough. :* For Patreon (early access + exclusives) and donations read below! ^^ My other ASMR channel (classic and weird stuff): StarLady ASMR https://www.youtube.com/channel/UCrjYB4DPyNAMM1TNlPb8R8g Please sub

Dhiyanoiseasmr

Feet ASMR playing with nail polish vials, glass sounds

For Patreon (early access + exclusives) and donations read below! ^^ My other ASMR channel (classic and weird stuff): StarLady ASMR https://www.youtube.com/channel/UCrjYB4DPyNAMM1TNlPb8R8g Please subscribe if you like my content, hit the bell, like, lea

Dhiyanoiseasmr

Hiro ASMR

Subs(800) Views(37306)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] 귀파주는 남자친구 롤플레이 (반말주의) (Role Play | Ear Cleaning Massage | Boyfriend RP | 3DIO MIC)

#히로 #남자친구롤플레이 #귀청소 Please wear earphones. 이어폰을 착용해주세요 안녕하세요 히로 ASMR입니다. 한 주는 잘 보내셨나요? 요즘 날씨가 너무 덥고 습해요... 그치만 모두들 힘내시고, 좋

Dhiyanoiseasmr

[No talking ASMR] 10가지 팅글 트리거 | 10 Tingle Triggers | Korean male ASMR

#히로 #tapping #TingleTriggers please put on your earphones. 이어폰을 착용해 주세요. 안녕하세요. 히로 ASMR입니다. 오늘은 노토킹 asmr입니다. 여러가지 사물태핑소리를 들려드릴게요. 영상이 좋으셨으면 ??

Dhiyanoiseasmr

(SUB) [ASMR] 안녕하세요 히로 헤어샵입니다.✂️ (Role Play | Hair Salon | Haircut | Korean ASMR | 미용실 롤플

#히로 #미용실롤플레이 #Roleplay please put on your earphones. 이어폰을 착용해 주세요. 00:00 하이라이트 00:50 면포소리 01:14 분무기 물소리 02:19 빗질과 스타일 상담 03:22 상한부분 커트 07:48 숱가위 13:06 ?

Dhiyanoiseasmr

SoftSoundSophie ASMR

Subs(798) Views(66369)

Last Update (07/2021)

Dhiyanoiseasmr

How to say ORANGE in 17 Different Languages | ASMR / Kako se reče ORANŽNA v 17 jezikih | ASMR

?? Hey! Today, we are going to learn how to say Orange in different languages. In this ASMR video, you will hear me whisper orange (oranžna, naranja, narančasta ...) in 17 languages and some candy rummage. I got an idea for this video while eating

Dhiyanoiseasmr

How to say LEAF in 25 Different Languages | ASMR / Kako se reče LIST v 25 jezikih | ASMR

?? Hey! In todays ASMR video, we are going to learn out, how to say LEAF (list, feuille, l'automne, ورقة الشجر, 葉, Blatt, лист, foglia, ...) in 25 different languages. In the video you can hear me whispering word 'leaf' and sounds o

Dhiyanoiseasmr

ASMR | Walking in High Heels | Black Ankle Boots | No Talking / ASMR | Hoja v čevljih z visoko peto

?? Hi! Today I have walking in high heels ASMR video. I am wearing black ankle heel boots and making various ASMR sounds with them on wooden flooring (tapping, heel sound ...). This is no talking video. I hope you will enjoy it. ✅ If you enjoyed

Dhiyanoiseasmr

Eun ASMR

Subs(1030) Views(71859)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | 테이프로 귀청소? | Ear Cleaning sounds with Tape | Sticky Sounds | 고인물 asmr | Tascam | No Talking

?Don't forget to set the resolution to 1080&wear headphones. 화질 1080 설정과 이어폰 착용 잊지마세요? ? 6/10 volumes are recommended. 볼륨은 최대 6/10 추천합니다 ? 안녕하세요 여러분~~~ 오늘도 요청영상이

Dhiyanoiseasmr

ASMR | (요청영상) 마사지볼 마이크 스크래칭✨| 귀가 간질간질 | Mic Scratching | 1K special | Tascam | No ta

?Don't forget to set the resolution to 1080&wear headphones. 화질 1080 설정과 이어폰 착용 잊지마세요? ? 6~7/10 volumes are recommended. 볼륨은 최대 6~7/10 추천합니다 ? 안녕하세요? 이번 영상은 구독자분?

Dhiyanoiseasmr

ASMR | 핀마이크 테스트 | 주사기로 긁기, 브러슁, 솜털귀청소 | New Mic Test | Scratching, Brushing, Ear Clean

?Don't forget to set the resolution to 1080&wear headphones. 화질 1080 설정과 이어폰 착용 잊지마세요? ? 7/10 volumes are recommended. 볼륨은 최대 7/10 추천합니다 ? 안녕하세요 여러분!! 오늘 영상은 핀마이

Dhiyanoiseasmr

ASMR limerence English

Subs(833) Views(48476)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Leather pants, skirt, leather gloves, grinding

Hello to all my dear lovers of ACMR! Welcome to my channel! My Russian channel: https://www.youtube.com/channel/UCUsyL49gX4VqQXyMIRiHXoQ?view_as=subscriber My Instagram: https://www.instagram.com/asmr__life/?hl=ru My first channel: https://www.yo

Dhiyanoiseasmr

ASMR FACE MASSAGE FOR YOU AND ME

Hello to all my dear lovers of ACMR! Welcome to my channel! My Russian channel: https://www.youtube.com/channel/UCUsyL49gX4VqQXyMIRiHXoQ?view_as=subscriber My Instagram: https://www.instagram.com/asmr__life/?hl=ru My first channel: https://www.yo

Dhiyanoiseasmr

ASMR Monica will rob you gently Role play for you|Please support my channel by subscribing and like

Hello to all my dear lovers of ACMR! Welcome to my channel! My Russian channel: https://www.youtube.com/channel/UCUsyL49gX4VqQXyMIRiHXoQ?view_as=subscriber My Instagram: https://www.instagram.com/asmr__life/?hl=ru My first channel: https://www.yo

Dhiyanoiseasmr

ASMR Moon

Subs() Views(68765)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Genuine leather gloves sounds (binaural sounds)

HELLO! Today's video is all about genuine leather gloves sounds using my 3DIO mic. If you love squeezing and rubbing leather sounds this video is for you. Sit back, relax yourself and enjoy it! Looking forward hearing your comments. Any suggestions are

Dhiyanoiseasmr

ASMR - Fully dressed with genuine leather: long leather gloves, leather boots, leather skirt, jacket

Hello there! For today's video i'm fully dressed with genuine leather, wearing long leather gloves, leather boots, leather skirt and jacket. Everything you see is 100% real leather. Sit back, relax yourself and enjoy it! Looking forward hearing your comm

Dhiyanoiseasmr

ASMR - Fully dressed up in leather (leather pants, leather blazer and leather gloves)

Hello there! For today's video i'm fully dressed up in leather, wearing leather pants, leather blazer and leather gloves. Sit back, relax yourself and enjoy it! Looking forward hearing your comments. Any suggestions are welcome. XoXo ?Thank you so m

Dhiyanoiseasmr

舔耳ASMR福利

Subs(5150) Views(787920)

Last Update (07/2021)

Dhiyanoiseasmr

桃桃ASMR来自性感兔女郎低胸黑丝美腿口含香蕉的挑逗让人受不了!性感耳骚娇喘口腔音(ear message,

希望大家点一下右下角的订阅,这是你们对我更新福利视频的最大动力。 资源打包+微信:965202465 Peach peach ASMR comes from the sexy bunny girl low-cut black silk beautiful legs with bananas to tease people can not stand! E

Dhiyanoiseasmr

桃桃ASMR红色吊带短裙蕾丝美腿摩擦你的耳朵!性感耳骚娇喘口腔音(ear message,blowing,pant from physical

希望大家点一下右下角的订阅,这是你们对我更新福利视频的最大动力。 资源打包+微信:965202465 Peach peach ASMR red suspender skirt lace legs rub your ears! Ear message,blowing,pant from physical weakness

Dhiyanoiseasmr

桃桃ASMR角色扮演女特务女间谍被捕惨遭蹂躏蕾丝美腿性感耳骚娇喘口腔音(ear message,blowing,pant from

希望大家点一下右下角的订阅,这是你们对我更新福利视频的最大动力。 资源打包+微信:965202465 Peach peach ASMR role-playing female spy female spy was arrested and suffered from lace, beautiful legs, sexy, ear, breath, (pa

Dhiyanoiseasmr

Vida. ASMR

Subs(125) Views(4884)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Eating Chicken Leg Piece, Curry, Rice and Papad || Eating Sounds

Don't Forget to like and subscribe to my channel. ***This is an ASMR video. To ensure all tingles please wear headphone. If you do not enjoy EATING SOUNDS and light whispers PLEASE DO NOT WATCH IT. Eating, chewing, gulping sounds etc...are done very loudl

Dhiyanoiseasmr

ASMR Eating Egg Curry Rice, Papad and Sweet Desert Halwa

ASMR Eating Egg Curry Rice, Papad and Sweet Desert Halwa Don't Forget to like and subscribe to my channel. ***This is an ASMR video. To ensure all tingles please wear headphone. If you do not enjoy EATING SOUNDS and light whispers PLEASE DO NOT WATCH IT.

Dhiyanoiseasmr

ASMR RAJMA CHAWAL || EATING SOUNDS

ASMR Rajma Chawal eatingh sounds Don't Forget to like and subscribe to my channel. ***This is an ASMR video. To ensure all tingles please wear headphone. If you do not enjoy EATING SOUNDS and light whispers PLEASE DO NOT WATCH IT. Eating, chewing, gulping

Dhiyanoiseasmr

ASMR N-GAZE

Subs(564) Views(56466)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Thai - Whispering - Mic Brushing - Ear Cleaning - 2021 June Compilations | N-GAZE

Welcome to ASMR N-GAZE ? Whisper Trigger Tapping etc. Anything Tingles ASMR Thai - Whispering - Mic Brushing - Ear Cleaning - 2021 June Compilations | N-GAZE My nick name is Note. I'm from thailand. Hope you enjoy and relax. Headphones or Earphones

Dhiyanoiseasmr

ASMR Thai - Whispering - Product's Name | N-GAZE

Welcome to ASMR N-GAZE ? Whisper Trigger Tapping etc. Anything Tingles ASMR Thai - Whispering - Product's Name | N-GAZE My nick name is Note. I'm from thailand. Hope you enjoy and relax. Headphones or Earphones for the best. ? Thank You for yo

Dhiyanoiseasmr

ASMR Thai - Whispering - Are human beings naturally Lazy? | N-GAZE

Welcome to ASMR N-GAZE ? Whisper Trigger Tapping etc. Anything Tingles ASMR Thai - Whispering - Are human beings naturally Lazy? | N-GAZE My nick name is Note. I'm from thailand. Hope you enjoy and relax. Headphones or Earphones for the best. ?

Dhiyanoiseasmr

Sonagi ASMR

Subs(21900) Views(1516563)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Brushing Hair & Whispering | about hair cut, some accident, tapping... (English sub)

In this video, you can hear whispering sounds while brushing my hair. Hope you enjoy ? If you'd like to support my channel : https://www.buymeacoffee.com/sonagiasmr ------------------------------------------------------------- ?Playlist ▶Sonagi'

Dhiyanoiseasmr

ASMR Ear Blowing & Layered Mic Rubbing Sound | Fluffy Windshield | Mic Touching | 1Hr (No Talking)

In this video, you can hear the sound of ear blowing and rubbing the mic at the same time. The mic rubbing sound is layered sound. Hope you enjoy ? If you'd like to support my channel : https://www.buymeacoffee.com/sonagiasmr -------------------------

Dhiyanoiseasmr

ASMR Mic Nibbling | Brain Melting Mic Eating | Intense Brain Eating | Kissing Sounds | Mouth Sounds

The sound of this video is very intense sounds, not soft sound like the "Ear Blowing ASMR" that I've uploaded a lot so far. Please adjust the volume ! And hope you enjoy ? If you'd like to support my channel : https://www.buymeacoffee.com/sonagiasmr

Dhiyanoiseasmr

WelshASMR82

Subs(4440) Views(412028)

Last Update (07/2021)

Dhiyanoiseasmr

?? ASMR I Learn Swedish

Hello! Hej! ?? ? I did a quick video of me learning some Swedish on Duolingo. Shall I do this sort of video again? Write me a comment! I hope you enjoy the video!! If you want, you can support me further. Here's how: On YouTube: Join thi

Dhiyanoiseasmr

Learning Russian ?? ASMR / Изучаю русский язык АСМР

Disclaimer: The dog isn't in the video (it's my mam's new dog ?) but I just liked the photo of my first time meeting her ❤️. Здравствуйте! ? В этом видео я изучаю русский язык снова с вами. Я

Dhiyanoiseasmr

ASMR Map of USA & Canada

Hello! ? I did a little map video to find out more about the North West USA and Canada, come and help me learn some more about this beautiful area of the world. Shall I do this sort of video again? Write me a comment! I hope you enjoy the video!!

Dhiyanoiseasmr

ASMR Ear Love

Subs(5560) Views(1682174)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 100% TINGLES (I BET)

Now you can order a video For the Donate - https://www.donationalerts.com/r/asmrearlove Please click 'Like' and comment! This will help promote the video and I will be very pleased! ASMR Community - https://vk.com/asmr_tapping ASMR moans #asmr

Dhiyanoiseasmr

ASMR OIL MASSAGE

Subscribe for MORE! https://vk.com/asmr_tapping

Dhiyanoiseasmr

ASMR lISTEN TO MY HEART (asmr mouth sounds)

ASMR lISTEN TO MY HEART (asmr mouth sounds) https://vk.com/asmr_tapping

Dhiyanoiseasmr

ASMattR ASMR

Subs(171000) Views(36389138)

Last Update (07/2021)

Dhiyanoiseasmr

A Livestream for ASMR Previously Run by ASMattR of An Airport for Aliens Currently Run by Dogs

In this ASMR livestream, I softly speak and whisper while playing An Airport for Aliens Currently Run by Dogs. Get ready to watch me pet some stock photos of dogs!!! Twitter - https://twitter.com/ASMattR Facebook - https://facebook.com/ASMattRpublic Insta

Dhiyanoiseasmr

ASMR | SCP-3943: "Taco Man" - A Binaural SCP Reading

Hey everyone! In this binaural ASMR video, I softly speak and whisper into your ears about SCP-3943, a taco vendor who somehow became stuck halfway into the side of an office building along with his taco cart. I hope you'll enjoy it! This video is based o

Dhiyanoiseasmr

[ASMR] Let's Build a Theme Park! RollerCoaster Tycoon 2 Soft-Spoken Gameplay

Hey everyone! In this ASMR video, I build a theme park in the classic PC game RollerCoaster Tycoon 2 while giving soft-spoken commentary. I hope you'll enjoy it! Interested in supporting my channel? Feel free to check out my Patreon page!: https://patreon

Dhiyanoiseasmr

All Bella ASMR

Subs(28600) Views(3362659)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ✨ Ear Eating, Ear Licking & Ear Noms ?✨

Welcome back to ALL BELLA ASMRrrrr! Hi Everyone! Hope you enjoy this Ear Eating, Ear Licking & Ear Noms video! May it give you some amazing TINGLES! LET ME KNOW WHAT YOU THINK! ?Make sure to LIKE, COMMENT & SUBSCRIBE! Please feel free to comment video

Dhiyanoiseasmr

ASMR ✨ Spanish Whispers & Relaxing Hand Movements

Welcome back to ALL BELLA ASMR! Hi Everyone! Hope you enjoy this Reassuring Spanish Whispers with Relaxing Hand Movement video! May it give you some amazing TINGLES and CALMNESS! LET ME KNOW WHAT YOU THINK! ?Make sure to LIKE, COMMENT & SUBSCRIBE! Plea

Dhiyanoiseasmr

ASMR ✨ Ear Kisses & Mouth Sounds ?✨

Welcome back to ALL BELLA ASMR! Hi Everyone! Hope you enjoy this Ear Kisses & Mouth Sounds video! May it give you some amazing TINGLES! LET ME KNOW WHAT YOU THINK! ?Make sure to LIKE, COMMENT & SUBSCRIBE! Please feel free to comment video ideas! Thank

Dhiyanoiseasmr

Light of Heart ASMR

Subs(298) Views(10580)

Last Update (07/2021)

Dhiyanoiseasmr

Twin Yeti ASMR No Talking ♡ Ear cleaning and ear attention with inaudible whispers

Don’t mind me as I mumble along, cleaning your ears in the tingliest way I can ♡ If you enjoyed this video, please like it and subscribe to my channel. If you are interested in live, interactive ASMR then follow me on Twitch https://www.twitch.tv/ligh

Dhiyanoiseasmr

Visual ASMR || Brushing your face with feathers to celebrate Pride

I was so worried that I wouldn't have this edited before the end of June! But here it is. My contribution to Pride Month. It didn't turn out exactly as I wanted it to, but I wanted to share the sentiment anyway. Please note, this is a safe space. Any nega

Dhiyanoiseasmr

Twin Yeti ASMR || Mic scratching and mic blowing with mouth sounds and inaudible whispers

This is an excerpt from my live Twitch stream. If you enjoyed this video, please like it and subscribe to my channel. If you are interested in live, interactive ASMR then follow me on Twitch https://www.twitch.tv/lightofheartasmr. I would love to hear fro

Dhiyanoiseasmr

Life & Love journey ASMR

Subs(2480) Views(402530)

Last Update (07/2021)

Dhiyanoiseasmr

Asmr OTOSCOPE/DEEP EAR Picking/Cleaning (no talking)

#asmr #asmrearexam #asmrearcleaning #asmrotoscope I hope you all enjoy this longer non talking ear picking session. sent with lots of love ???

Dhiyanoiseasmr

ASMR CLOSE WHISPER

#asmr #asmrearexam #asmrwhisper

Dhiyanoiseasmr

ASMR Scalp EXAM

#asmr #asmrexam #asmrscalp Hope you enjoy the audio guys ?????

Dhiyanoiseasmr

Trigger Happy ASMR

Subs(159000) Views(18999892)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Brain Melting Triggers

0:00 Preview 2:12 Ear Muff Brushing 7:12 Brushes on Ear Muffs 10:30 Tapping Brushes 13:45 Tapping & Scratching Brushes Together 17:05 Little Cups 22:40 Big Cups 26:00 Big Cups + Mouth Sounds 27:33 Lid Sounds with Big Cups 29:00 Lid Sounds With Smalls Cup

Dhiyanoiseasmr

This ASMR Will Make You So Sleepy

?Twitch : https://www.twitch.tv/triggerhappy_asmr ?Music https://www.youtube.com/channel/UChfGNGhuW8WlGSNDunR7Sdg?view_as=subscriber ?Twitter: https://twitter.com/BupeHappy ?Merch: https://triggerhappyasmr.com/merch/1564602 ?Instagr

Dhiyanoiseasmr

ASMR Highly Sensitive Sound Assortment

?Twitch : https://www.twitch.tv/triggerhappy_asmr ?Music https://www.youtube.com/channel/UChfGNGhuW8WlGSNDunR7Sdg?view_as=subscriber ?Twitter: https://twitter.com/BupeHappy ?Merch: https://triggerhappyasmr.com/merch/1564602 ?Instagr

Dhiyanoiseasmr

novaruu asmr

Subs(11600) Views(1052035)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Aggressive Ear Licking & Eating From Your Cute Blue Hair Girlfriend

If you like what I do and want to support me, I have a fans page that I am sure you'd enjoy. You can find all my links at https://novaruu.com/links My links: ➜ Non-ASMR Youtube- @Novaruu ➜Twitch- https://bit.ly/2YFR4DO ➜Twitter- https://bit.ly/2Y

Dhiyanoiseasmr

ASMR Bedtime Story | Brushing | Positive Affirmations

If you like what I do and want to support me, I have a fans page that I am sure you'd enjoy. You can find all my links at https://novaruu.com/links Business Inquiries only: novaruuofficial@gmail.com Edited by Watson - contact hwatsonofficial@gmail.com My

Dhiyanoiseasmr

ASMR Ear Eating & Licking ??(Kisses, mouth sounds, TINGLY Nom Noms)

If you like what I do and want to support me, I have a fan page that I am sure you'd enjoy. You can find all my links at https://novaruu.com/links Business Inquiries only: novaruuofficial@gmail.com My links: ➜ Non-ASMR Youtube- @Novaruu ➜Twitch- h

Dhiyanoiseasmr

Soft ASMR

Subs(165000) Views(30753132)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Trying Snacks From the Netherlands ??

? My Last Video: *updated* What's On My iPhone? ➜ https://www.youtube.com/watch?v=YMNyYFdWYvw Get your own box: https://www.trytreats.com?aff=51 Use my code 'SOFTASMR15' for 15% off your first box! :) WHAT I'M WEARING: TOP: https://api-shein.shein.

Dhiyanoiseasmr

ASMR *updated* What's On My iPhone?

? My Last Video: Neighborhood Gossip Part 2 ➜ https://www.youtube.com/watch?v=FoXwSZSz9L8 WHAT I'M WEARING: DRESS: NECKLACES: https://amzn.to/3ohEpmN​, https://amzn.to/35gkRYu EARRINGS: https://amzn.to/3mwKR8b LIPS: NYX Liquid Suede in Sandstorm

Dhiyanoiseasmr

ASMR - Neighborhood Gossip Part 2

? My Last Video: GRWM | Everyday Makeup Chit Chat ➜ https://youtu.be/4JGuxC_WZDQ Mary’s Neighborhood Gossip: https://www.youtube.com/watch?v=szEx0ZV1ECI&list=LL&index=56&t=721s Part One: https://www.youtube.com/watch?v=a9NtfcEWVr0&t=478s WHAT I'M

Dhiyanoiseasmr

Olive ASMR

Subs(76800) Views(16929793)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] 너도 10분안에 잠들 수 있어 ?폼폼폼|You can sleep in 10 minutes|あなたは10分で眠れます

7가지 소리를 짧게 편집했어요! 취향인 소리도 찾고 수면과 휴식에도 도움이 되기를 바라요! 개인적으로 거품터지는 소리가 같이 들리는 이어커핑이 최애... 00:00~01:22 프리뷰 preview プレビュー 0

Dhiyanoiseasmr

[ASMR] 아늑..?우드캔들과 포근한 귀청소?|Cozy mood's ear cleaning with birch candle|花火の音と心地?

편안함에 최적화 하기위해 다소 거친 부분은 일부 편집했어요! 스르륵 잠들기에 도움이 되시기를 바랍니다 (´ㅅ` )♡? ?low light 05:00~21:56 ⭐️비슷한영상 Similar video 似通った動画 ▶️https

Dhiyanoiseasmr

[ASMR] 드르륵?보석 관통#2| Jewel scratch penetration ASMR|だだだっ宝石を擦る貫通音

관통의 중간부분 소리에 초점을 맞춘 영상입니다! 좌 우 의 소리보다 중간부분의 소리가 가깝게 들려요. 마치 귀가 가운데 있는것같은 기분을 느낄 수 있습니다(*˘︶˘*).?? ⭐️비슷한영상

Dhiyanoiseasmr

Mewlies ASMR

Subs(15900) Views(1496262)

Last Update (07/2021)

Dhiyanoiseasmr

(ASMR) Gentle Visuals for Sleep ♡ Long Nails Lens Scratching

Hey Sleepyhead! ? I've gotten a lot of requests for visual tingles, I'm going to incorporate them more often! ? Like and loop for more of this trigger! ? Subscribe for more tingly videos ? Join me on my other media!? Become part of the Fame

Dhiyanoiseasmr

(ASMR) ♡ Ear Licking & Brain Scratching Tingles

Hey Sleepyheads ? Thanks for for 15k subs! Your special earlicking tingles, but now with brain melting scratches! ?? Like and loop for more of this trigger! ? Subscribe for more tingly videos ? Join me on my other media! ? Become part of

Dhiyanoiseasmr

(ASMR) Placing Kisses on You ♡ Soft ♡ Sensitive Mouth Sounds

Hey Sleepyheads ? Do you like up close ear kisses and tingly mouth sounds? ? Like and loop for more of these triggers! Subscribe for more tingly videos ? Join me on my other media! ? Become part of the Famewlie on TWITCH: https://www.twitch.t

Dhiyanoiseasmr

Bearded Audio ASMR

Subs(768) Views(14014)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Tapping On A Wood Box | #Shorts

Here's a nice lil' tapping video for you. Have a great weekend! If you love my work and would like to help me save up for better video gear, join my merry Band of Beards on Patreon! One tier, super cheap, fun for everyone: https://www.patreon.com/beardeda

Dhiyanoiseasmr

ASMR | Measuring Your Entire Body // Personal Attention, Writing Sounds, Soft Spoken Male Voice

It's an exciting day! You're finally being measured for your suit. We'll get your measurements from head to toe, because your entire body will be covered. Gotta keep your identity a secret, right? If you love my work and would like to help me save up for

Dhiyanoiseasmr

ASMR | You are an android with an echo problem // Fixing You, Android Repair, Echo, Gentle Tool Work

Looks like you've got a bit of an echo problem? Your audio phase bolts might need some tweaking, so I'm gonna open up your head's side panels and give 'em a twist. After that you'll be converting audio without that echo, good as new. I love working on old

Dhiyanoiseasmr

DireHit ASMR

Subs(121000) Views(16545803)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Doctor Cranial Nerve Exam Male Roleplay For Sleep & Anxiety (Ear Eye Exam Hearing Test Light)

ASMR Doctor Cranial Nerve Exam Male Roleplay For Sleep & Anxiety (Ear Eye Exam Hearing Test Light). I will examine the 12 cranial nerves with examinations for your medical procedure. Your Asmr exam rp will include hearing test, realistic exam, questions, N

Dhiyanoiseasmr

ASMR Fast & Aggressive Doctor Cranial Nerve Exam #shorts Roleplay

ASMR Fast & Aggressive Doctor Cranial Nerve Exam #shorts Roleplay. You just came in the doctor express line for your cranial nerve exam because you don't have much time. here we go Full Length Relaxing Cranial Nerve Exam: https://youtu.be/gMWGH47fYak If

Dhiyanoiseasmr

ASMR Realistic Haircut & Shave Barbershop Roleplay For Men (Clipper, Spray Bottle & Layered Sounds)

ASMR Realistic Haircut & Shave Barbershop Roleplay For Men (Clipper, Spray Bottle & Layered Sounds). Trim, Scissors, Razor, Face Touching Personal Attention Hair Care Beard Clean up. Today you guys are all male and you need a haircut because you haven't go

Dhiyanoiseasmr

iPad ASMR

Subs(3800) Views(63017)

Last Update (07/2021)

Dhiyanoiseasmr

?iPad ASMR - ?Kings And Queens of England? - Henry II (5/42)

Hello friends! Today we are continuing learning about the Kings and Queens of England! Today we are looking at Henry II. I hope that you will find this relaxing as well as informative! Please dont forget to like this video, leave a comment and subscribe!

Dhiyanoiseasmr

?iPad ASMR -❓What's on my iPad?❓Part #3

Part 1: https://youtu.be/y_Kdr3OP8fI Part 2: https://youtu.be/ve0WAODn_9s My Main ASMR Account - https://www.youtube.com/whisperaudiosasmr Products used: -iPad Air 2020 (10 inch, Rose Gold) -Apple Pencil 2nd generation -Goodnotes app -Screen protector -

Dhiyanoiseasmr

?iPad ASMR -❓What's on my iPad?❓Part #2

Part 1 can be viewed here : https://youtu.be/y_Kdr3OP8fI Please dont forget to like this video, leave a comment and subscribe! My Main ASMR Account - https://www.youtube.com/whisperaudiosasmr Products used: -iPad Air 2020 (10 inch, Rose Gold) -Apple P

Dhiyanoiseasmr

ASMR Art of Sound

Subs(129000) Views(19059057)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 8D Mic Scratching w/Spoolie and Slow Whispering [Around Your Head]

In this ASMR: slow whispering in 8D style around your head with mic scratching using a silicone spoolie and nails. What's your fave: 8D pure whispering or 8D whispering combined with some triggers (suggest yours)? ⭐ More 8D ASMR: https://youtube.com/play

Dhiyanoiseasmr

ASMR Ear Cleaning 8D + 3D Binaural [Around Your Head + Through Your Brain]

In this ASMR, I combined 2 ear cleaning/inner ear digging tracks (with silicone spoolies!): 8D around your head sound and a regular 3Dio binaural/ 3D kind of audio. This way, the sound travels around you and through your brain at the same time to create a

Dhiyanoiseasmr

ASMR Intense Mic Scratching - NO COVER - Deep Whispering

In this ASMR: deep and bassy ear play with mic scratching and no cover on. Scratching includes: metal mic mesh, rhinestones around the mic and spider mounts. Plus ear to ear whispering, of course! This is a little bit of a rough/aggressive trigger for thos

Dhiyanoiseasmr

ASMR Brushear

Subs(8540) Views(2032872)

Last Update (07/2021)

Dhiyanoiseasmr

Dry Hard LUX Soap Carving and Cutting - ASMR

ASMR Dry Hard Lux Soap Carving and Cutting. Yes. Another LUX Soap because I loved the texture. Crumbly Soap Pieces. This is to rush, and I am not very pleased with it. But why waste it. Check out my IG , soap.crumbles.asmr Thank you for watching guys.

Dhiyanoiseasmr

LUX Dry Hard Soap Cutting Carving, Soap Crumbles - ASMR

ASMR Lux Dry Hard Soap Crumbles Cutting and Carving. Short video of soap cutting. Sorry I been away for a quite sometime, been busy with work. I'll try to do a comeback, thank you for staying with me guys. I post this video on my instagram too @soap.crumbl

Dhiyanoiseasmr

Speed Up ASMR INTENSE! Hard Wire Bristle Brush - Crackle Sounds

Speed Up ASMR INTENSE - Hard Wire Bristle Brush. Brushing the Mic. Crackle Sounds I hope you guys enjoyed the speed up version of this video. Thank you for watching ? until next time. Original version as per link at the view attribution below. Ol

Dhiyanoiseasmr

ASMR MaryJLeeee

Subs(40600) Views(3805341)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR CALMING YOU BEFORE BED ? Personal Attention

Calming You Before Bed Personal Attention! Some Words of Affirmation for you to relax to before bedtime. Enjoy :) Please Like, Subscribe, and Comment if you liked this video ^^ **I stream LIVE ASMR on Twitch Monday-Thursday** https://twitch.tv/maryjleeee

Dhiyanoiseasmr

ASMR SLOW SCRATCHING ?

Happy tingles, my friends :) **I stream LIVE ASMR on Twitch Monday-Thursday** https://twitch.tv/maryjleeee Please Like, Subscribe, & Leave me a comment! I read them all :D Thanks for watching ♡♡♡ Follow Me! on other Social Media: https://instagram.

Dhiyanoiseasmr

ASMR HELPING YOU RELAX ? Personal Attention

Enjoy this Words of Affirmation video! My Twitch ASMR community adores these and I hope my YouTube fam loves it just as much! Enjoy :) **I stream LIVE ASMR on Twitch Monday-Thursday** https://twitch.tv/maryjleeee Please Like, Subscribe, & Leave me a comme

Dhiyanoiseasmr

Little Clover Whispers

Subs(108000) Views(10734259)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | The Sun is the Enemy - How to Protect Against your Biggest Foe ☀️

During today's video I talk a bit about my new sunburn (yes, I wore sunscreen.. I'm a pale boi, okay??) and how YOU CAN PROTECT YOURSELF AGAINST THE SUN! Step one... Stay inside! I hope you find this video as tingly as my skin is feeling right now! Excus

Dhiyanoiseasmr

ASMR | Spending Time with your Girlfriend at the Beach ?? Satisfying Roleplay

Wake up sweetie.. You fell asleep on the sandy shore! It's super hot outside and your girlfriend wants to spend some quality time with you! This video features popsicle nomming, soft noises of the waves hitting the beach, sunscreen application and sand rem

Dhiyanoiseasmr

ASMR | Model Goes Live and Answers Sweet Messages ?

I hope you enjoy this roleplay of a model going live on one of her special platforms and chatting with her fans while answering her emails and comments! I chat with people online for hours every day and it was fun to give you a bit of an insight as to what

Dhiyanoiseasmr

Gentle Whispering ASMR

Subs(2090000) Views(900308597)

Last Update (07/2021)

Dhiyanoiseasmr

Color Analysis ? ASMR ? Soft Spokenish

Hello friends :) today we'll be taking a closer look at what colors suit my dear husband Darryl best. I hope you enjoy this different type of a video from this channel ♥ Color analysis is a tool designed to help us figure out the colors that are synergy

Dhiyanoiseasmr

Things that Spark Joy ○ ASMR ○ Soft Spoken ○ Chit Chat

Hello :) How have you been? What's new in your world? I've been a bit more exhausted and unsettled lately (said every stay at home parent, lol) BUT also very grateful for my life and today we'll do a chit chat, deal? :D 00:00 why no cool videos, Maria? 02

Dhiyanoiseasmr

Fancy Fabrics ○ ASMR

Welcome to my Fabric Shop, let me show you some of our most amazing materials ♥ 00:00 Preview 3 min long :) 03:18 Welcome 04:02 White flower tulle 10:51 Large layered sequins 16:28 Lint rolling 18:44 Blue velvet with golden applique 26:07 Orange iridesc

Dhiyanoiseasmr

Ekko ASMR

Subs(5780) Views(321667)

Last Update (07/2021)

Dhiyanoiseasmr

Satisfying Ear Licking ASMR! (ASMR) - The ASMR Collection - Ekko ASMR

Hey guys! I hope you enjoyed my video! If you want to see other videos and show your support, please check out my ONLYFANS! This is the only way I can make a profit off my videos and is the way I can keep making them! Even if you arent into that kind of

Dhiyanoiseasmr

Stimulating and Tingly Ear Licking For My favorite Fan (ASMR) - The ASMR Collection - Ekko ASMR

Hey guys! I hope you enjoyed my video! If you want to see other videos and show your support, please check out my ONLYFANS! This is the only way I can make a profit off my videos and is the way I can keep making them! Even if you arent into that kind of

Dhiyanoiseasmr

Slippery and Gooey Slime ASMR (ASMR) - The ASMR Collection - Ekko ASMR

Hey guys! I hope you enjoyed my video! If you want to see other videos and show your support, please check out my ONLYFANS! This is the only way I can make a profit off my videos and is the way I can keep making them! Even if you arent into that kind of

Dhiyanoiseasmr

Corey ASMR

Subs(25000) Views(566526)

Last Update (07/2021)

Dhiyanoiseasmr

Most Requested Tik Tok Livestream ASMR Triggers! | 27th ASMR Video

Hey ASMR LOVERS! Corey ASMR here! Founder of the myASMR App! ASMR This is my 27th ASMR Video on this channel! ASMR stands for Autonomous Sensory Meridian Response! It’s those tingly feelings that you get when you hear and/or see something satisfying!

Dhiyanoiseasmr

SUBSCRIBE! ASMR :)

Dhiyanoiseasmr

Light Triggers ASMR Video | Shoutout to Justin! | 26th ASMR Video

Need a high quality mic???? This video is sponsored by Fifine Mic Fifine Mic here: https://fifinemicrophone.com?aff=1095 Hey ASMR LOVERS! Corey ASMR here! Founder of the myASMR App! ASMR Shoutout to Justin for the Light Triggers Video idea! This is my 2

Dhiyanoiseasmr

ASMR YUN

Subs(16300) Views(1384169)

Last Update (07/2021)

Dhiyanoiseasmr

【ASMR】溫柔的心理咨詢師幫你舒緩壓力+輕語+觸發音|중국어 심리상담사 ㅣASMR psychological counseling

Instagram: http://www.instagram.com/kristinalove... WEIBO:李允儿辣么可爱 #ASMR​ #中文ASMR​ #ChineseASMR​ #중국어ASMR​ #relaxing​ #sleeping​ #RoleplayASMR

Dhiyanoiseasmr

【ASMR】雷雨天前女友來家借宿+溫柔輕語幫你掏耳朵|전여친 귀청소 해줄게요|Ear cleaning roleplay

Instagram: http://www.instagram.com/kristinaloverrr​ WEIBO:李允儿辣么可爱 #ASMR​ #中文ASMR​ #ChineseASMR​ #중국어ASMR​ #귀청소​ #EarCleaning​ #relaxing​ #sleeping​ #RoleplayASMR #RainstormSounds​ #천둥빗소리​

Dhiyanoiseasmr

【ASMR】溫柔的牙醫姐姐幫你治療壞掉的牙齒? 치과의사 상황극| Dental treatment Roleplay

Instagram: http://www.instagram.com/kristinaloverrr​ WEIBO:李允儿辣么可爱 #ASMR​ #中文ASMR​ #ChineseASMR​ #중국어ASMR​ #relaxing​ #sleeping​ #RoleplayASMR

Dhiyanoiseasmr

Caroline ASMR

Subs(621000) Views(135701743)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 17 Earbud Mic Triggers for Brain Melting Tingles and Relaxation (Lofi/No Talking)

? Hi hi! Welcome to a new experimental ASMR video ~ I tried using Apple earbuds as microphones and tested out a variety of sounds like crinkling, tapping, scratching, and some different textures to see how the earbuds would do :3 Thanks to Shawn for edi

Dhiyanoiseasmr

ASMR 8D Clicky Keyboard Typing for Sleep, Study, and Background Noise (No Talking) ⌨️

#ASMR #Typing #NoTalking ?? Welcome to a new typing sound assortment - in 8D! This includes a large print keyboard, 2 different bamboo keyboards, a soft silicone-like key caps keyboard, and a few other clicky keyboards. Which one is your favorite? I

Dhiyanoiseasmr

ASMR Asking You EXTREMELY PERSONAL Questions ?️? (Pen Writing, Whisper, Storm)

Hello there! Welcome to the Question Clinic! ? I would love to know your answers in the comments below, if you’re comfortable sharing any of them ? P.s. Did you catch which question I asked twice? :') P.p.s. It was actually storming when I was reco

Dhiyanoiseasmr

Tishe ASMR

Subs(1510) Views(76142)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - RELAXING NAIL TAPPING SOUNDS (FAST&SLOW)

HI guys! You will see ASMR NAIL TAPPING video and I hope you will like it ❤️PLEASE WATCH TILL THE END❤️ Please support me with your likes and comments! Subscribe to see more videos and don't forget to turn on the notifications. WATCH MY OTHER

Dhiyanoiseasmr

ASMR - BODY SCRATCHING SOUNDS RELAXING FULL OF TINGLES FOR YOUR SLEEP

HI guys! This is longer version of body scratching video so I hope you will like it more than short one) ❤️PLEASE WATCH TILL THE END❤️ There will be RELAXING TINGLY BODY&CLOTHES SCRATCHING SOUNDS FOR YOUR SLEEP. I LOVE THIS SOUNDS SO MUCH! Hope

Dhiyanoiseasmr

ASMR - CLOSE UP. 5 MIN AND YOU WILL FALL ASLEEP. BODY SCRATCHING

HI guys! This is my first short ASMR video with body scratching sounds. I want to test this type of video so will see if you like it or not)) ❤️PLEASE WATCH TIL THE END❤️ There will be CLOSE UP and TINGLY BODY&CLOTHES SCRATCHING SOUNDS. I hope

Dhiyanoiseasmr

Mental Health Magick ASMR

Subs(916) Views(24806)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR tuning fork healing balancing the elements within you

Be aware of volume as sound may be kind of loud.

Dhiyanoiseasmr

ASMR sounds of the elements

Dhiyanoiseasmr

ASMR earth healing*rattle, feathers, incense, crystals*transmute negative energy with Welsh magick*

I apologize that Im not making good eye contact. I thought I was looking in the right place and found out I was a bit off after the video was made lol Thank you for your patience as I learn these new skills of sharing energy work and magick via the interne

Dhiyanoiseasmr

Karen Singing ASMR

Subs(6110) Views(697521)

Last Update (07/2021)

Dhiyanoiseasmr

Slow ASMR cover of The Chauffeur by Duran Duran

Hey guys, what is up? I've captured for you some of Amsterdams more sinister sides to combine with this song, but the city obviously is gorge! I'm not back on the channel, this was just a song my loving husband really wished I make for his birthday, which

Dhiyanoiseasmr

? Relax with me and Austin with his ASMR Tongue Drum! ?

Please wear headphones for the binaural effect! Hey guys, I hope you like this collaboration with Tongue Drum Journey's Austin. He's an awesome being, and please go subscribe to him here: https://bit.ly/2zPVxsx There's also our second video there on his c

Dhiyanoiseasmr

Peek into the Berlin ASMR Spa

I want to thank Emma WhispersRed for setting up the most beautiful event ever, and the boys for making this lovely video for us! That's me in the thumbnail, having a break from back drawing and enjoying the sound session in the star room, and ASMR Paul :3

Dhiyanoiseasmr

TomG SoftTalkASMR

Subs(786) Views(88477)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR SoftTalk - The Beauty of Poppies - A look at Celtic Ogham ☆ Gentle Calm Voice

Hello and welcome to my ASMR channel a place to relax and be present. Filmed on 12th June 2021 with some footage from last week on my birthday. Enjoy a relaxing peaceful video to help relax you but also to bring hope love joy and perhaps a little wisdom

Dhiyanoiseasmr

ASMR SoftTalk - Violet Flame with Silver and Gold - Onto a Path of Love ☆ Gentle Calm Voice

Hello and welcome to my ASMR channel a place to relax and be present. Written by TomG and created on 9th June 2021. A little mantra to clear dense heavy negative energies away up through the violet flame and onto a path of love. Please consider LIKE and SU

Dhiyanoiseasmr

ASMR SoftTalk - Celtic Ogham Huath (Hawthorn) - Relaxing Energy ☆ Gentle Calm Voice

Hello and welcome to my ASMR channel a place to relax and be present. Filmed on 16th May 2021. A loving gentle energy of The May Tree the Hawthorn and signing the Celtic Reiki symbol of Hauth is rhis little gift of healing energy. Thanks for all the kind

Dhiyanoiseasmr

Snowy ASMR

Subs(24100) Views(2358657)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Lets Nap Together ~ Personal Attention ?

Hope you enjoy!! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please note this is 18+ only) ?Patreon - https://www.patreon.com/snowylowther ?Twitter - @xsnowy ?Tiktok - @snowysioux ?Tips - https://www.paypal.com/

Dhiyanoiseasmr

DEEP Ear Picking ASMR - Ear Cleaning Roleplay

This was highly requested! A Ear Cleaning of JUST the Picking tool! Its my favourite sound too and I loooove this trigger in ASMR :) Hope you enjoy!! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please note this is 18+ only)

Dhiyanoiseasmr

Classic Eye Examination ASMR Roleplay

A classic eye examination with glove sounds, follow the light, snellen reading chart, field of vision test, eye drops and person attention with soft spoken/whispering...Enjoy! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please

Dhiyanoiseasmr

Seafoam Kitten's ASMR

Subs(216000) Views(60304166)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - LITTLE RABBIT ~ Meeting a Weird Rabbit Person at Your Hotel ~

You're tired. You're just trying to get back to your hotel room when you're stopped in the hallway by a rather odd person. They are dressed up like a rabbit and call themselves Banana. Chuckling to themselves and speaking in breathy whispers, they seem to

Dhiyanoiseasmr

ASMR - FLUFFY SCALP MASSAGE ~ Brushing You to Sleep | May Patron Appreciation!

Thank you to my $5+ patrons of May, I appreciate you! Sorry this video is like two weeks late but hey at least I uploaded something this time :'DD anyway I hope you enjoy the fluffy ear massage! TIMESTAMPS: 0:59 - Reading your names 6:04 - Fluffy massage!

Dhiyanoiseasmr

ASMR - SAD BOI HOURS ~ Comforting You in the Night | 101 Reasons to Stay Alive ~

Your friend is here to comfort you during sadboi hours!! They give you some tea, silly gifts that make nice tapping sounds, and affirmations while reading a list of reasons to stay alive. I did not write this list!! I initially found this list from a you

Dhiyanoiseasmr

Celaine's ASMR

Subs(257000) Views(36592470)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Fast & Aggressive Cranial Nerve Exam w/ THE WRONG TOOLS Medical Doctor Roleplay Eye, Light, Ear

ASMR Fast & Aggressive Cranial Nerve Exam w/ THE WRONG TOOLS Medical Doctor Roleplay Eye, Light, Ear. ASMR FAST & AGGRESSIVE Cranial Nerve Exam Doctor Roleplay, Medical Examination, Eye, Light, Ear. ASMR DETAILED Cranial Nerve Exam FAST Medical Role Play,

Dhiyanoiseasmr

ASMR Cranial Nerve Exam with THE WRONG TOOLS #shorts medical examination, eye, muscle, CHAOTIC ✨

ASMR Cranial Nerve Exam with THE WRONG TOOLS #shorts medical examination, eye, muscle, CHAOTIC ✨ #asmrcranialnerveexam #asmrfastandaggressive #shorts

Dhiyanoiseasmr

ASMR Spa Facial Treatment, Layered Sounds, Eyebrow Plucking, Personal Attention & Check In ?

ASMR Spa Facial Treatment, Layered Sounds, Eyebrow Plucking, Personal Attention & Check In ?. Welcome to the more fast pace spa for a dreamy and sleepy peaceful night. This is an asmr video for those who love skincare asmr, a spa facial treatment with a

Dhiyanoiseasmr

Whisperwind ASMR

Subs(7250) Views(583685)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | The Peddler Helps You on Your Quest | Into the Forest, Part I

Zot the peddler has returned, so you approach her to return the valuable crest you borrowed from her previously. What else might she have to offer you today? This video is the beginning of a new adventure! Subscribe to catch the whole story! New to the

Dhiyanoiseasmr

ASMR Black Widow Gives You a Checkup | Checking You for a Concussion

You've been recruited as a new initiate into the Avengers! You've been put through rigorous training to determine your skills, and you took a hit in an exercise earlier today. Black Widow is here to look you over and make sure you're okay! ASMR check up,

Dhiyanoiseasmr

ASMR Vampire Interviews You For Her Faction | Ronnie the Protector

So you wanna be a vampire, huh? Well, thanks to the Institute, qualified candidates can go through an extensive screening process to make all your undead dreams come true! You've jumped through all the hoops, and there's only one thing left to do: you need

Dhiyanoiseasmr

April’s ASMR

Subs(270000) Views(32759917)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | The Most BEAUTIFUL Assortment of Fast & Aggressive Triggers! | Mouth Sounds ✨

Huge thank you to Deezer for including me in this Deezer ASMR Challenger! My Deezer Playlist HERE: https://www.deezer.com/en/channels/asmr WHERE CAN YOU FIND ME FOR MORE CONTENT?! Twitch: https://www.twitch.tv/aprilsasmr Instagram: https://www.instagra

Dhiyanoiseasmr

ASMR | 100+ FAST & AGGRESSIVE TRIGGERS ⚡️

Thank you to everyone who's been reaching lately! :) Business Inquiries: Abuckmgmt@gmail.com WHERE CAN YOU FIND ME FOR MORE CONTENT?! Twitch: https://www.twitch.tv/aprilsasmr Instagram: https://www.instagram.com/aprilmbuckles/ Twitter: https://twitter.co

Dhiyanoiseasmr

ASMR | Lofi Chaotic, Fast & Aggressive ASMR ⚡️

Start speaking a new language in 3 weeks with Babbel ? Get up to 65% off your Babbel membership ▶️ HERE: https://go.babbel.com/6m50-youtube-aprilsasmr3-april-2021/default Business Inquiries: Abuckmgmt@gmail.com WHERE CAN YOU FIND ME FOR MORE CONTE

Dhiyanoiseasmr

ASMRsense

Subs(36300) Views(1535036)

Last Update (07/2021)

Dhiyanoiseasmr

Astrology ? ASMR ? ALL SIGNS

Hello my fellow tingle astrology lovers ? Today let's see what stars have for us for the month of July. Please comment your sign and like each others' to see how many of each sign we have here! 00:00 Introduction 00:47 Aries ♈ 04:23 Taurus ♉ 08:58

Dhiyanoiseasmr

UNUSUAL TRIGGERS • ASMR • NO TALKING

Hello friends :D Today we'll play with unique sounds and aesthetically pleasing objects that make our brain melt, I hope you enjoy it! 00:00 Preview 05:19 Glitter Pencil Pouch 15:19 Glitter Pencils 28:15 Notebook 36:28 Paper Flower Bouquet 48:32 Sequin R

Dhiyanoiseasmr

Writing in English for YOUR Enjoyment ASMR

Hello friends, I wanted to practice some speaking and writing English letters to share with you today. I hope you will enjoy the sounds and learn along with me! 00:00 Hello 02:40 Notebook 05:15 Pens 06:26 Writing 15:44 Pencils 16:40 Writing 27:10 Markers

Dhiyanoiseasmr

JUNE ASMR

Subs(3450) Views(285093)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Scratching ONLY/ Rug/Pearl/Ball/Old Speaker (No Talking)

Hello, everyone! Welcome back! In today’s video, there are still scratches with some heavy flavors. I hope you like them. If you like gentle scratches, please be careful. today are four kinds of items, which have been marked on the title, but the pearl

Dhiyanoiseasmr

ASMR Scratching On Wood, washboard, wallet, etc.(NO TALKING)

Hello everyone, and welcome back. In today's video, I will show you some new objects. They are: wood, imitation wood grain wallet, rhinestone fish wallet, rhinestone cuff bracelet, mesh earrings, washboard, I hope these are awesome Unrelated items can be l

Dhiyanoiseasmr

ASMR Scratch /tapping on different objects (NO TALKING)

Hello everyone, and welcome back. In today’s video, I chose Jigsaw, (4 years old children playing, LOL, I bought scratches) The second object is a wooden lighthouse, I feel this object is very artistic , And then quilling card. It's a scroll art, I feel

Dhiyanoiseasmr

asmrlovely

Subs(3190) Views(260912)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Gym Membership Consultation & Sign Up ? // Measuring You Roleplay

Hello Lovelies! I hope you enjoy ASMR | Gym Membership Consultation & Sign Up ? // Measuring You Roleplay Welcome to the Lovely Gym! I think I know just the right thing for you and your fitness goals. Join me in your gym consultation and sign up to rec

Dhiyanoiseasmr

ASMR | Men's Shave Barber Shop Roleplay ? | Beard Shave, Trim, & Style

Hello Lovelies! I hope you enjoy ASMR | Men's Shave Barber Shop Roleplay ? | Beard Shave, Trim, & Style Welcome to the Men's Shave Barber Shop! Today I will be helping you with your beard by providing you with an all inclusive beard shave, trim, and st

Dhiyanoiseasmr

ASMR | Night Nurse Takes Care of You In Bed ♥ // Nurse Checkup Medical Routine

Hello Lovelies! I hope you enjoy ASMR | Night Nurse Takes Care of You In Bed ♥ // Nurse Checkup Medical Routine Shhhh...it's 11 PM and your night nurse is here to take care of you [in bed]. I hope you are enjoying your hospital visit so far. Sorry to wa

Dhiyanoiseasmr

LeftHandedLarri504 ASMR

Subs(3660) Views(952936)

Last Update (07/2021)

Dhiyanoiseasmr

Crunchy BSN w/ Holi Powder

Hey y’all! First and foremost, I wanna thank all of you for wishing me a happy birthday, I had a pretty great day. Got my second shot yesterday and I definitely felt the effects this morning to the point where I had to clock out of work. I was sufferin

Dhiyanoiseasmr

My Birthday Behavior ????? • Celebrate With Me • 16 Block Crush

Yes! Today is my birthday! ?? I thank God for another year, first and foremost, because most were not able to wake up today. I wanna celebrate with my lovely subs because you all have been there with me since day one. As you all know, or may not know

Dhiyanoiseasmr

Soft, Pink Crumbles ? • Broken Gym Chalk • ASMR

As much as it bothers me that BSN comes in pieces, it’s not as bad as when the box comes dirty. The chalk smelled like dirty rainwater, but oh well ??‍♀️ what can you do? Still a nice crush, nonetheless. I hope y’all enjoy otherwise. Than

Dhiyanoiseasmr

ASMRtherapy

Subs(3580) Views(752082)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Reporting a Crime to the Police ● Soft Spoken Roleplay

ASMR Roleplay where you are at the local police station reporting that your apartment has been burglarized. I (a police officer working there) will assess the situation and make a report to help you retrieve your items. Everything is soft-spoken and made s

Dhiyanoiseasmr

[ASMR] Dream Job Interview ● Soft Spoken Roleplay

I got an offer you can't refuse... but for this, you will need to take part in this job interview. It's not a usual one by any means.. but again the job itself is quite unusual as well. Hope you enjoy this little ASMR roleplay :) ► Please subscribe if y

Dhiyanoiseasmr

ASMR Robot Check Up & Repair - Roleplay - Relaxing Whisper and Triggers

Anual space robot check-up and repairs roleplay. Whispering and using various different trigers. Whispering roleplay made for relaxation and falling asleep faster. ► Please subscribe if you want some more ► ASMR Therapy Album Vol.1 on Bandcamp (fr

Dhiyanoiseasmr

ASMR Around The Universe

Subs(362) Views(18583)

Last Update (07/2021)

Dhiyanoiseasmr

ASMRtist Reacts to Tiktok / Instagram ASMR

Triggers in this video: whispering, entertainment! xD PS thumbnail and video inspired by ASMR Winkeyy ____ Thanks for watching! I post on Tuesdays and Saturdays, see you soon!! ___ My equipment: Mic - Blue Yeti Nano Camera - iPhone 11 ___ Socials: Instagra

Dhiyanoiseasmr

ASMR 1 Minute Doctor Checkup Roleplay (fast)(tingly)

Enjoy! Triggers in this video: whispering, writing, visual triggers, follow the light, mouth sounds, hand sounds, tapping ____ Thanks for watching! I post on Tuesdays and Saturdays, see you soon!! ___ My equipment: Mic - Blue Yeti Nano Camera - iPhone 11

Dhiyanoiseasmr

ASMR Except I Am Glass, Wood, Plastic, Etc (TAPPING GALORE) [inspired by Eevy ASMR]

Ready for a tsunami of tingles? This ASMR video will surely have that effect! Triggers in this video: Tapping on glass, plastic, wood, and other items; scratching; whispering ___ Thanks for watching! I post on Tuesdays and Saturdays, see you soon!! ___ My

Dhiyanoiseasmr

Tingting ASMR Shorts

Subs(18700) Views(307484)

Last Update (07/2021)

Dhiyanoiseasmr

Cranial Nerve Exam ~ Tingting ASMR #Shorts

Watch the full video here: https://youtu.be/p_Toephthkg Tingting ASMR #Shorts Main Channel: https://www.youtube.com/TingtingASMR

Dhiyanoiseasmr

10 ASMR Triggers for Sleep ~ Tingting ASMR #Shorts

Watch the full video here: https://youtu.be/Gca-XyKcb1U Tingting ASMR #Shorts Main Channel: https://www.youtube.com/TingtingASMR

Dhiyanoiseasmr

Relaxing Haircut ~ Tingting ASMR #Shorts

Watch the full video here: https://youtu.be/LuV7lEo2U48 Tingting ASMR #Shorts Main Channel: https://www.youtube.com/TingtingASMR

Dhiyanoiseasmr

ASMRrequests

Subs(497000) Views(139123562)

Last Update (07/2021)

Dhiyanoiseasmr

☀️⛱️ Summertime Self-Care | ASMR | Tapping, Scratching, Soft Speaking, Unboxing

**Disclaimer: I’ve partnered with FabFitFun on this video. This is my impression of the FabFitFun box, and all opinions are my own - and I LOVE IT!!!! ? Use my code [ASMR10] for $10 off: https://fabfitfun.com/welcome/ Hello my friends and fellow Ting

Dhiyanoiseasmr

ASMR - ?? Reading You to Sleep - Soft Speaking, Whisper, Tapping, Page Turning

Good evening and happy Easter and Passover, my friends and fellow Tingleheads! I've been feeling kind of sickly over the last week, so I had to take it easy on shooting - but I wanted to make sure to do at least a LITTLE something for y'all...so here ya go

Dhiyanoiseasmr

ASMR - All Up In Your Ears 3 - Ear cleaning, brushing, cupping, personal attention, & more

Good evening, my friends and fellow Tingleheads! It's been a little while, so I thought it was about time for me to get back UP IN YO EARS!! This is a primarily no talking video, with a teensy bit of whispering thrown in. I hope you enjoy! ❤ For those w

Dhiyanoiseasmr

Lara Soft ASMR

Subs(2380) Views(94269)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Random Personal Attention with touching, plucking, measuring, brushing for deep relaxation

————————-— *CUSTOM VIDEOS ON MY PATREON* ————————— ??? larasoft_asmr ——————————-— ??????? ?? ——————————— ? *DONATE* or leave a tip f

Dhiyanoiseasmr

ASMR Deutsch / German | Ich kühle dich ab! Flüstern, Trigger & Personal Attention #asmrdeutsch

————————-— *CUSTOM VIDEOS ON MY PATREON* ————————— ??? larasoft_asmr ——————————-— ??????? ?? ——————————— ? *DONATE* or leave a tip f

Dhiyanoiseasmr

ASMR Detsch / German | ?Lara's Love Talk Teil 2! ?Die grosse Liebe & Herzschmerz #asmrdeutsch

So, Schnarchhasis! Tadaaa viel Spass bei Teil 2 von Lara's Love Talk ASMR ;-p Im nächsten Teil gehts dann um Tinder Dates... ;-p ————————-— *CUSTOM VIDEOS ON MY PATREON* ————————— ??? larasoft_asmr ——??

Dhiyanoiseasmr

Moonlit Bible ASMR

Subs(2160) Views(185196)

Last Update (07/2021)

Dhiyanoiseasmr

Slow, Soft Whisper, Tapping, & Layered Sounds For Sleep ✞ The Armor of God ✞ Whisper Bible ASMR

I had to take down this video and re-upload it due to an error discovered by a kind viewer who pointed it out to me! I pray you are blessed by this! In this video we will learn how wearing the Belt of Truth will guard a Christian from the lies and dec

Dhiyanoiseasmr

The Armor of God – Belt of Truth ✞ Slow, Soft Whisper Bible ✞ Study of Ephesians 6 ✞ Christian ASMR

In this video we will learn how wearing the Belt of Truth will guard a Christian from the lies and deceits of Satan, false teachers, and false beliefs. We will also see how we can resist and stand firm against the enemy’s attacks, and come out victoriou

Dhiyanoiseasmr

Victory Over Spiritual Battles ✞ Whisper Bible ASMR ✞ Christian ASMR ✞ Ephesians 6

What a triumph there is for those of us in Christ! I had a renewal of spiritual zeal making this video! Discovering the victory that is ours through the simple choice of just standing firm in the strength of the Lord is thrilling and invigorating to the

Dhiyanoiseasmr

Wokies ASMR

Subs(58000) Views(9233905)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Ear Cupping | Cricket Sounds | Ambient Noise | 3DIO

The crickets outside sounded so nice! I hope this helped you fall into a very relaxed state. :) Part 2 of Ear Licking free on OF! ?Like and Subscribe! ?Onlyfans: https://onlyfans.com/wokiesasmr ?Links: https://linktr.ee/WokiesASMR ?Business I

Dhiyanoiseasmr

ASMR Girlfriend Comforts Your Headache | Soft Spoken

It was lightly raining outside. I hope this video helps soothe your head. :) ?Like and Subscribe! ?Onlyfans: https://onlyfans.com/wokiesasmr ?Links: https://linktr.ee/WokiesASMR ?Business Inquiries/Custom Video Requests: wokiesasmr@gmail.com

Dhiyanoiseasmr

ASMR Fabric Scratching | No Talking

I hope these fabric sounds help you relax and possibly fall asleep! :) ?Like and Subscribe! ?Onlyfans: https://onlyfans.com/wokiesasmr ?Links: https://linktr.ee/WokiesASMR ?Business Inquiries/Custom Video Requests: wokiesasmr@gmail.com ------

Dhiyanoiseasmr

Purple Dream ASMR

Subs(1370) Views(106241)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Brushing my Hair ? No Talking

? Violetta ASMR - https://www.youtube.com/c/ViolettaASMR ? Violetta PLAY - https://www.youtube.com/c/ViolettaPLAY ? Twitch - https://www.twitch.tv/violetta_purpur ? Instagram - https://www.instagram.com/violetta_purpur/ ?Facebook - https://w

Dhiyanoiseasmr

ASMR Cosmic Tuning Fork ? No Talking

? Violetta ASMR - https://www.youtube.com/c/ViolettaASMR ? Violetta PLAY - https://www.youtube.com/c/ViolettaPLAY ? Twitch - https://www.twitch.tv/violetta_purpur ? Instagram - https://www.instagram.com/violetta_purpur/ ?Facebook - https://w

Dhiyanoiseasmr

ASMR Scalp Inspection, Lice Check, Hair Brushing ? No Talking

Triggers in this video: Scalp Inspection, Scalp Massage, Lice Check, Personal Attention, Hair Brushing ? Violetta ASMR - https://www.youtube.com/c/ViolettaASMR ? Violetta PLAY - https://www.youtube.com/c/ViolettaPLAY ? Twitch - https://www.twitch

Dhiyanoiseasmr

The Cozy Hospital ASMR

Subs(609) Views(30940)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Hospital Intensive Care / Code Blue Medical Role Play

Welcome back to the Cozy Hospital! Today you are in intensive care under close observation. Dr. Cozy will come in to do a night exam. She will listen to your chest and abdomen with a stethoscope (4:56) and then do a neurological exam with a light (6:54)

Dhiyanoiseasmr

ASMR Surgery Hernia Repair | Medical Role Play

Welcome back to the Cozy Hospital! In today's medical ASMR role play, you have an inguinal hernia and Dr. Cozy is going to repair it with mesh. She will go over your chart and some prep questions for you (00:44) and then you will be given an epidural to

Dhiyanoiseasmr

ASMR Surgery | Bone Marrow Biopsy Role Play

Welcome back to the Cozy Hospital! Today you are here for a bone marrow biopsy, but don't worry, Dr. Cozy will make it as painless for you as possible. After speaking to you about it, the doctor will place an IV so you won't feel any pain (2:28 - needle

Dhiyanoiseasmr

Atmosfera ASMR

Subs(11000) Views(373409)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Dentista Atencao Pessoal Atmosfera Asmr Roleplay

ASMR Dentista Voz suave Roleplay Atmosfera Asmr Video de ASMR com voz suave para relaxar sentir arrepios e dormir rapido. Sons relaxantes oara dormir Asmr com roleplay atencao pessoal dentista atendendo voce sm relaxante teclado scratching Asmr soft spoken

Dhiyanoiseasmr

ASMR Lendo para voce dormir Chuva SUSSURROS Reading Whispering

ASMR Lendo para voce dormir SUSSURROS Video de ASMR com leitura sussurrando de orelha a orelha para relaxar ter arrepios e dormir rapido. Asmr ear to ear com sussurros e lendo livro. Asmr lendo para dormir Video de Asmr para relaxar arrepiar com leitura

Dhiyanoiseasmr

ASMR COMPRINHAS Sussurros intensos para dormir Atmosfera Asmr

ASMR COMPRINHAS Sussurros intensos para dormir Atmosfera Asmr Video de Asmr mostrando comprinhas com sussurro intenso para relaxar arrepiar e dormir rapido. Asmr sussurrando no seu ouvido para relaxar e dormir em poucos minutos. Video mostrando objetos de

Dhiyanoiseasmr

Olivie

Subs(1130) Views(45698)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Baby Tiger Adoption | Adoption Agency Roleplay | Pet Adoption | Adoption Day

Finally! I am so proud of this roleplay and SO excited for you to watch it! [ASMR] Baby Tiger Adoption | Adoption Agency Roleplay | Pet Adoption | Adoption Day 0:00 - 7:30 Your Application 7:31 - 34:48 Toys&Food 34:49 - 39:10 Baby Tiger Subscribe to

Dhiyanoiseasmr

[ASMR] Nature Sounds | Relaxing Walk | Sounds Of Nature | Walking In The Park Birds Chirping #Shorts

Relaxing birds sounds while walking in a huge park complex pretty near my home. [ASMR] Nature Sound Relaxation | Relaxing Sleep-Bird Chirping Sounds | Soothing Forest Birds Singing Subscribe to become a LOVE GANG Member here: https://www.youtube.com/chann

Dhiyanoiseasmr

[ASMR] Frames Fitting #Shorts | Personal Attention | Glasses Fitting Roleplay

Let me help you see clearer this May with personal attention and frame fitting. [ASMR] Frames Fitting After A Medical Test For Pilot #Shorts | Personal Attention Subscribe to become a LOVE GANG Member here: https://www.youtube.com/channel/UC2EL7x9g9HDEZWU

Dhiyanoiseasmr

Molgar ASMR

Subs(272) Views(9854)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Morning Affirmations

Dhiyanoiseasmr

baby’s gone we having wine tonight

Dhiyanoiseasmr

it's my birthday lets make some asmr

It's my birthday!

Dhiyanoiseasmr

Rayy SMR

Subs(18800) Views(4912588)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Weird Fruit and a Binaural Walk in a Rainforest

Hello! This would have been uploaded yesterday, but I need to buy better internet. The upload speed couldn't handle all this fruity goodness. Hope no one else in these apartments needed to use the internet! - - - - - Hi, my name is Sunny and I make this

Dhiyanoiseasmr

ASMR - New Microphone Test (Audio Only)

Hello! This was made pretty last minute in order to have something. It has been a crazy week and I'm really not feeling well today, but at least I could accomplish something! : ) I got a new microphone and I wanted to test out its quality for speech. It a

Dhiyanoiseasmr

ASMR - Moody Artist Works on You (Scratching, Scraping, Brushing, Quiet Whispers)

This video was the first major wake-up call that the space I am in (and/or the way the space is being utilized) is utterly inefficient. There are reasons, some of which are not easy to get around at the moment, but everything is about to shift and then mor

Dhiyanoiseasmr

ChinchillaSoft ASMR

Subs(342) Views(15416)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Life Update with My New Dog | Close Up Whispers and Fluffy Mic Brushing ?

Hello! Thanks for watching ChinchillaSoft ASMR. On this channel, I want to help you relax with soft and slow triggers. In this video I am just giving a little close up, whispered update on what I have been up to and why I have not been uploading! I hope yo

Dhiyanoiseasmr

ASMR | Guided Relaxation | Up Close Whispers

Hello! Thanks for watching ChinchillaSoft ASMR. On this channel, I want to help you relax with soft and slow triggers. In this video I want to help you relax and fall asleep with some simple instructions and close up whispers. I hope you enjoy :) I hope t

Dhiyanoiseasmr

LoFi iPhone ASMR | Up Close Personal Attention, Camera Brushing, and Tapping ?

Hello! Thanks for watching ChinchillaSoft ASMR. On this channel, I want to help you relax with soft and slow triggers. In this lofi video I am kind of whispering and softly speaking to you to celebrate reaching 300 subscribers! I hope you enjoy :) Thank y

Dhiyanoiseasmr

ASMR unharu 언하루

Subs(3190) Views(176444)

Last Update (07/2021)

Dhiyanoiseasmr

[고인물은 못 참긔?] ASMR 빠른 입소리 2탄 | mouth sounds fast earcleaning ASMR

좋아요 와 구독 꾹 눌러주세요? Like and subscribe? 안녕하세요 언하루의 경철입니다 :-) Hello, I'm UNHARU :-) 오늘도 시청해 주셔서 감사합니다 ☺ Thanks for watching☺ 여러분의 오늘 하루는 어떠??

Dhiyanoiseasmr

[진성주의] 구독자 2000명 기념 Q&A 질문받기? | Ask me a question Q&A!!

좋아요 와 구독 꾹 눌러주세요? Like and subscribe? 안녕하세요 언하루의 경철입니다 :-) Hello, I'm UNHARU :-) 오늘도 시청해 주셔서 감사합니다 ☺ Thanks for watching☺ 여러분의 오늘 하루는 어떠??

Dhiyanoiseasmr

기쁜 마음을 감출 수 없는 뒤죽박죽 수다 ASMR | 새로운 마이크 블루예티 | MY NEW MIC BLUE YETI

좋아요 와 구독 꾹 눌러주세요? Like and subscribe? 안녕하세요 언하루의 경철입니다 :-) Hello, I'm UNHARU :-) 오늘도 시청해 주셔서 감사합니다 ☺ Thanks for watching☺ 여러분의 오늘 하루는 어떠??

Dhiyanoiseasmr

Tyson ASMR

Subs(65900) Views(7239848)

Last Update (07/2021)

Dhiyanoiseasmr

How To Give Yourself Intense ASMR Tingles (Part 6) - Self Induced ASMR Sensations - Sleep Inducing

How to get intense asmr tingles using an ancient technique ? Join this channel to get access to perks: https://www.youtube.com/channel/UCK2ZIpAgJhHRH5Ex2j3Nw-A/join Tip Jar: paypal.me/tysonhamblin Don't forget to like and subscribe and hit the bell!

Dhiyanoiseasmr

ASMR New Tattoo Tour | Realism Sleeve Tattoo | Meaning, Pricing, Pain

I finally got more work done on my sleeve after a year and a half! I absolutely love it :) I will go into the meaning, pricing, story behind each piece, and the pain. Join this channel to get access to perks: https://www.youtube.com/channel/UCK2ZIpAgJhHRH

Dhiyanoiseasmr

ASMR Asking You Insanely Personal Questions (Uncomfy) - Writing Sounds - ASMR Roleplay

asking you extremely personal questions Asmr Roleplay Join this channel to get access to perks: https://www.youtube.com/channel/UCK2ZIpAgJhHRH5Ex2j3Nw-A/join Tip Jar: paypal.me/tysonhamblin Don't forget to like and subscribe and hit the bell! Support m

Dhiyanoiseasmr

DeesSofterSide

Subs(4940) Views(776404)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Whisper Show and Tell- My Shot Glass Collection

I have collected shot glasses for a few years now and so I wanted to feature some in a whisper for you to enjoy. I hope you like it, Sleep Sweet Everyone!

Dhiyanoiseasmr

Whisper Catching Up, I've Missed You Guys!

Thank you for all your patience with me over the years! I've finally invested a bit of money into recording with more than just my iPhone. This will help me to stay more consistent. I hope you enjoy catching up with me a bit. Please comment any requests, h

Dhiyanoiseasmr

ASMR Whisper Sign Language Fingerspelling Lesson

Hi strangers! lol. I am trying to get back into this and thought it would be fun to teach you all how to fingerspell. I hope you enjoy this video, sorry if the editing is weird. I also referenced TheLyricalWhispers. Check him out. Hes awesome. Enjoy! Sleep

Dhiyanoiseasmr

SLOBB TV ASMR

Subs() Views(363672)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR CHEESY CHEESY CHICKEN PIZZA & SWEET CHILI CHICKEN STRIPS | MUKBANG

#chickenpizza #cheesepizza #chickenstrips #satisfying #sweetchilisauce #sweetchilichicken #cheesepizzamukbang #cheese #mukbang #asmrmukbang #asmreating #eatingshow #eatingsounds #eating #food #asmrfood #foodie #socialeating #SLOBBTVASMR #pizzahut #littlece

Dhiyanoiseasmr

ASMR CHEESY NOODLES, SEAWEED RICE BALLS & FRIED EGGS | MUKBANG | MASSIVE BITES

#cheesynoodles #riceball #indomiegoreng #bigbites #massivebites #hugebites #mukbang #eatingshow #notalking #mukbangasmr #eatasmr #softeatingsounds #noodleeatingsounds #pastamukbang #noodlemukbang #cheesynoodlemukbang #asmrmukbang #asmr #asmrcommunity #asmr

Dhiyanoiseasmr

ASMR FIRE CREAMY ROSE TTEOKBOKKI | RICE CAKE| SWEET CHILI CHICKEN FINGERS & CORN DOGS | MUKBANG

#rosetteokbokki#ricecake #corndogs #springrolls #nuclearfiresauce #ASMRTIST #ASMRcommunity #ASMR #ASMRmukbang #ASMRFood #Eatingshow #Eatingsounds #ASMREatingnotalking #asianfood #koreanfood #koreanmukbang #ricecakes #mozzarella #cheese #spicy #spam #sausag

Dhiyanoiseasmr

Adrian ASMR

Subs(2380) Views(202275)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Full Body Massage 2!! (Soft Spoken, Personal Attention)

Welcome back everyone!!! This is the highly requested Full Body Massage Part 2! I really hope you all enjoy :) Thank you all for your incredible support! ❤️❤️

Dhiyanoiseasmr

ASMR - My Favorite Albums of 2020! (Whispered)

Welcome back everyone! I hope you all had a fantastic Christmas and New Years! The long awaited Albums video is here :) I hope you all enjoy! Don't forget to relax ??

Dhiyanoiseasmr

ASMR League of Legends Volibear Gameplay! ? (Keyboard, Mouse Sounds)

Welcome back everyone!! I hope your all doing fantastic :) Doing another League video today! The next will be a roleplay I promise :) Hope you all enjoy!! Don't forget to relax ??

Dhiyanoiseasmr

Basic ASMR

Subs(737) Views(30887)

Last Update (07/2021)

Dhiyanoiseasmr

(For My Subscribers) Quick Channel Update - Talking and Whispering

Hi Guys, sorry I've been away for a while, I explain all in the video, I will be back soon though, just need to get used to the work and study life, then Ill have enough time to make quality content. In case you wonder, I recently had a shower and I mois

Dhiyanoiseasmr

Best/First ASMR Lego Sounds x 4 - Intense Tingles Guaranteed.

Welcome to my ASMR Lego Sounds x 4, Intense Tingles Guaranteed. there is a bit of chatter at the beginning followed by blissful Lego sounds, if you're not into Lego, its worth a try, and if you are into Lego sounds, then you're in for a treat. Enjoy.

Dhiyanoiseasmr

ASMR - Sorting then Counting Quality Street Chocolates - Methodical ASMR

Ever wondered how many chocolates are in a tin of Quality Street, or how many of each type? Today on Basic ASMR we will be sorting and counting a whole tin of 'Quality Street - Christmas 2019 Edition'. If you're not familiar with ASMR and just enjoy sort

Dhiyanoiseasmr

The ASMR Review Show

Subs(4050) Views(704425)

Last Update (07/2021)

Dhiyanoiseasmr

What Is The ASMR Review Show?

NEW AND IMPROVED INTRO CUZ THE OLD ONE WAS SUPER CRINGE! Hello everyone! Welcome to The ASMR Review Show! My channel is all about reviews of various media in the style of ASMR. The intent is to give you something to relax to or throw on in the background

Dhiyanoiseasmr

Dead Space: Extraction - ASMR Gameplay (All Bosses / Highlights)

The next Dead Space game to get the ASMR gameplay treatment is the lesser known prequel originally released on the Wii in 2009: Dead Space: Extraction. While this game wasn't as big of hit as the main 3 games in the series, I do think it's important to cov

Dhiyanoiseasmr

Dead Space - ASMR Gameplay (All Boss / Highlights)

It's time to do an ASMR playthrough of my favourite video game series: Dead Space. In a slight twist from my usual ASMR gameplay videos, this video is not just about the bosses of Dead Space, as it also includes highlights from my favourite moments in the

Dhiyanoiseasmr

Catplant ASMR

Subs(398000) Views(81867396)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Whispered Unboxing w/ Close up Triggers (tapping, scratching + other trigger sounds!)

Can you guess the song? Deezer, a global music streaming service, is giving 20 members of the ASMR community a 6 month Premium code (worth $60). That means unlimited access to music and podcasts with zero ads, free downloads and cool features like Flow, a

Dhiyanoiseasmr

ASMR - Lofi Tapping (random rambling trigger sounds - whispered)

I loveee Helix! Thank you for helping me get better sleep. Visit helixsleep.com/catplant to get up to $200 off your Helix mattress, plus two free pillows.

Dhiyanoiseasmr

ASMR - Soft-Spoken Tapping on Objects that I LOVE (vinyl, dvd, plushies, earrings, video game stuff)

Get 20% OFF + Free Shipping @MANSCAPED with promo code CATPLANT20 at MANSCAPED.com! #sponsored #manscaped

Dhiyanoiseasmr

ASMR Universe

Subs(369) Views(21513)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Relaxing & Soothing Brain Massage for Sleep [Mic Scratching No Talking]

Hey everybody! ? Welcome to a new microphone scratching video, with the addition of nails, for a deeper and more intense scalp/brain massage! I hope you like it! Hello ?? YouTube! Welcome to ASMR Universe. I stumbled across ASMR Videos & couldn'

Dhiyanoiseasmr

My Morning Routine | ASMR Fast & Slow Tapping & Scratching Using Shampoo, Hair Gel Bottles & More..

#asmr #asmrtapping Hey everybody! ? I am mostly tapping plastic shampoo bottles, body wash and more... I hope you like it! :) Hello ?? YouTube! Welcome to ASMR Universe. I stumbled across ASMR Videos & couldn't believe the the sensations (tingl

Dhiyanoiseasmr

Relaxing & Calming Visual ASMR | Playing Solitaire [No Talking] Gentle Tapping & Mouth Sounds

#asmr #visualasmr Hey everybody! ? Slightly different video today. This is more tapping (no pun intended!?) into more visual ASMR. Don't worry though, there is some tapping & mouth sounds in there too! Enjoy. Hello ?? YouTube! Welcome to AS

Dhiyanoiseasmr

ASMR Sound

Subs(267) Views(27971)

Last Update (07/2021)

Dhiyanoiseasmr

Asmr without words. Feathers on the microphone, pleasant sounds for your ears.

Listen, friends, to the sound of a feather on the microphone, I hope the goosebumps will please you.. ⛳️Place of shooting: Moscow ?Video shot with: SONY FDR-AX53 camcorder and BLUE YETI microphone. All videos as well as sounds were filmed and rec

Dhiyanoiseasmr

ASMR sounds. Antistress toy POP IT.

Listen to friends here is such an ASMR and a toy POP IT. I hope you get goosebumps)) ⛳️Place of shooting: Moscow ?Video shot with: SONY FDR-AX53 camcorder and BLUE YETI microphone All videos as well as sounds were filmed and recorded by me person

Dhiyanoiseasmr

Asmr video. Sticky, soggy, multicolored soap.

Hello friends! I love soaking soap, soft and pleasant to the hands. I share with you a new video, pleasant views. ⛳️Place of shooting: Moscow ?Video shot with: SONY FDR-AX53 camcorder and BLUE YETI microphone All videos as well as sounds were fil

Dhiyanoiseasmr

Sweet Nothings ASMR

Subs(378) Views(15583)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Travel Agent Books Your Next Destination ~ Soft Spoken ~ Typing Sounds || Italy Edition ||

Hey guys! I hope everyones had/having a wonderful day! :) For todays video I'm going to be booking your holiday to magnificent Italy :) For the majority of us at the moment we aren't able to travel so I thought it would nice to dream a little. Italy is a c

Dhiyanoiseasmr

[ASMR] My Golden Box of Relaxing Tingly Sounds

Hello Loves! I really hope you enjoy my new video! :) 00:00 Golden Box Intro 02:25 Glass Jar of Styrofoam Balls 07:56 Shells in Mesh Bag 11:29 Angel Hair (or fairy floss ;P) 15:29 Sea Glass 18:33 Bag of Diamonds 22:31 Slime 27:10 Page Flipping 31:16 Silver

Dhiyanoiseasmr

[ASMR] Personal Attention off an Elvish Princess ~ Soft Spoken

Hello loves! I'm a huge fan of LOTR and and I've always wanted to dress up as an elf so here we are :) It's a lil' blurry at the beginning I'm sorry but it does sort it's self out. So sit back, relax and hopefully enjoy :) Lots of Love! x ***If you enjoye

Dhiyanoiseasmr

adrimarie ASMR

Subs(414) Views(22993)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Starbucks Haul

Hello! I am back :) Thanks everyone for being so patient. I am lucky to have such dedicated viewers like you so soon into starting my channel. I work full time and also go to university full time so it has been hard for me to make new content this past m

Dhiyanoiseasmr

ASMR Relaxing Fast Typing (no talking)

Hello! In this video I am helping you relax as you watch me type - for tingles, study, work, or sleep. Please let me know if you liked it by dropping a comment below. Thanks!

Dhiyanoiseasmr

ASMR - Follow the Light(s)!

Hello! In this video I am trying out one of my personal favorite triggers - follow the light. I have some flashlights/glowsticks and all you have to do is follow them with your eyes and feel relaxed. Thank you for watching!

Dhiyanoiseasmr

ASMR Interlude

Subs(2450) Views(167480)

Last Update (07/2021)

Dhiyanoiseasmr

[1 Minute ASMR] Sketching You

Hey everyone! Do you like this 1 minute ASMR trend? I think it’s super fun and useful if you wanna relax for a bit but don’t have a lot of time :)) Enjoy!

Dhiyanoiseasmr

[ASMR] Update!! :)

♥️♥️♥️

Dhiyanoiseasmr

[ASMR] Pokémon Cards & Monopoly Unboxing

Here is another long-awaited Pokémon video for you all!! Thank you for your patience. As I said in the video, it has been nearly impossible to find any cards, but I plan to keep making videos like this as soon as I find some more! Thank you for all the su

Dhiyanoiseasmr

ASMR KYH

Subs(158) Views(24935)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR FR ❣️ - FIRST RP ? BARBER SHOP ?

✨✨ Casque ou écouteurs recommandés ! ✨✨ Bonjour à vous ! Bienvenue dans mon tout premier RP BARBER SHOP ! C'était tout bizarre car je n'ai pas du tout l'habitude haha ! J'espère que vous allez apprécier, n'hésitez pas à me donner vos

Dhiyanoiseasmr

ASMR FR (TALKING) - Je vous dévoile enfin ma voix ! ? + triggers ✨

✨✨ Casque ou écouteurs recommandés ! ✨✨ Hello les amis ! Aujourd'hui est un jour spéciale car j'ai décidé de PARLER (ou plutôt chuchoter ^^) dans mes vidéos. Youhou, je me lance enfin et je dois vous avouer que j'aime beaucoup haha. J'ai

Dhiyanoiseasmr

ASMR (No talking) - ❣️ Déclencheurs satisfaisants ❣️ (silicone, water spray, sequin..)

✨✨ Casque ou écouteurs recommandés ! ✨✨ Salut salut ! Je reviens avec une vidéo un peu plus longue parce que étant moi-même une dévoratrice de longue vidéo ASMR, j'essaye de reproduire ce que j'aime tout simplement. ? N'hésitez pas

Dhiyanoiseasmr

ASMR Cap

Subs(3420) Views(246126)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Bloons TD 6 - Satisfying Balloon popping

Hi it's ASMR Cap from Germany. In the ASMR Bloons TD 6 - Satisfying Balloon popping Video I do play Bloons TD 6. I really love the sounds the balloons do when they are popping so I thought I should record some gameplay and upload it to my ASMR channel. Ti

Dhiyanoiseasmr

ASMR Rubbing Sounds on a Wooden Table (no talking)

Hi it's ASMR Cap from Germany. In the ASMR Rubbing Sounds on a Wooden Table (no talking) Video I'm rubbing my hands on a wooden table to create some awesome Sounds. Timestamps: You click the subscribe button ? Become a channel member and get exclusive

Dhiyanoiseasmr

MrBeast Rap Song

This is the MrBeast Rap Song. If you like MrBeast you will love this Rap Song about him and his friends Chris and Chandler. #mrbeast #mrbeastrap #rap

Dhiyanoiseasmr

Also Maya ASMR

Subs(4770) Views(141048)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Close Whispers & Word Tracing ? (Positive words to make you feel good!) ✨

Hey everyone :3 Tonight we are tracing positive words to brighten your mood and make you feel good! I whisper and trace letter by letter to make you sleepy eheh Hope you enjoy this video! xx _____________________________________ ? My Patreon Family ?

Dhiyanoiseasmr

ASMR to help you with Anxiety | Mic brushing, Close Whispers, Hand movements, Guided Breathing ?

Hi there :3 For today's video I decided to do a very low light environment so we can just relax and be easy on our eyes! Lots of mic brushing, close whispers and some hand movements. I also wanted to help you focus on controlling your breathing and practic

Dhiyanoiseasmr

ASMR | Asking you extremely personal questions! ? (Whispered Roleplay + Keyboard Sounds)

Hi :3 Today I will ask you super personal questions! Keep in mind that these were not targeted at anyone specifically, they are just for the purpose of the video! I've seen some of these videos with questions and I love them so much, so I wanted to do my o

Dhiyanoiseasmr

ASMR Music Relaxing Music

Subs(289) Views(5131)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Music Relaxing ??Brain massage intense??

Musique ASMR aide à se relaxer et à s'endormir plus facilement... ASMR Music to help relax and fall asleep easily...

Dhiyanoiseasmr

ASMR Music Meditation Relaxation ???

musique de méditation avec crépitement de feu

Dhiyanoiseasmr

ASMR Music? Sensitive Triggers For Sleep ?

Musique ASMR aide à se relaxer et à s'endormir plus facilement ASMR Musicto help relax and fall asleep easily #asmrmusic #relaxingmusic #brainmassage

Dhiyanoiseasmr

Sagris ASMR

Subs(1660) Views(151048)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Vietnam| Kí túc xá Sagris| Nói thì thầm

ASMR Sagris ASMR roleplay Vietnamese ASMR Vietnam ThanhASMR Vietnam ASMR Vietnamese Dorm for students Welcome to Sagris Dorm! I am talking about Sagris Dorm with a lot of good facilities such as accommodation, services, library, entertainment, kitche

Dhiyanoiseasmr

ASMR Greek| Day Month and Year| ημέρα μήνα και έτος| Sagris

Sagris ASMR ASMR whispering Asmr whisper ASMR GREEK GREEK ASMR Greece asmr Asmr greece Day, Month and Year Today, I’d like to talk about Day, Month and Year in Greek and how to know which months have 30 or 31 days I hope you like my Greek Thank you

Dhiyanoiseasmr

ASMR Vietnam| Makeup you| Trang Điểm bạn| Lots of Personal Attention | Sagris

Time stamp 00:00 greeting - lời chào 01:07 remove makeup - Tẩy trang 04:38 wipe face - lau mặt 06:07 touch hair - xoã tóc 06:20 brush hair - chải tóc 08:26 hair cut - cắt tóc 10:48 brush face - phủi tóc 12:54 clean face - lau mặt

Dhiyanoiseasmr

MissASMR

Subs(258000) Views(70507703)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Oh Yes I love It? Tiiingly Whispers ft Dossier

Dossier has a welcome offer of up to %20 on the website. You can get up to 30% off for your first order by using the discount code - Missasmr10 - http://bit.ly/3bWGEb9 Hey guys! Welcome to another asmr favourites where I will show you my favorites with cl

Dhiyanoiseasmr

ASMR Traitement Du Visage RolePlay ~ ASMR Français ?

Salut mes amours! Voici une nouvelle vidéo asmr français tellement improvisee! j’espère que vous allez aimer la vidéo et que ça vous donnera de la relaxation ❤️ abonnez -vous a ma chaine de vlog - https://bit.ly/3dhSL28 Hey loves! This is a ne

Dhiyanoiseasmr

ASMR Relaxing Whisper & Kiss Sounds ? BIG NEWS - New Mic Test Tonor Q9

Hello ASMR family! Links and discount code for the Tonor mic - https://bit.ly/3cTtko0 https://amzn.to/2Rb2qAG and get 15% off with the code TONORQ9MIC This asmr video is whisperer and I used a new microphone for this video. Hope you will like the sound. F

Dhiyanoiseasmr

Whispers of the Wolf ASMR

Subs(33700) Views(1951594)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR REIKI plucking & scooping anxious thoughts | hand movements, negative energy removal | healing

ASMR REIKI plucking & scooping your anxiety | hand movements, negative energy removal | energy healing and chakra balancing 00:00 intro 01:41 intention setting with candle 02:46 sage smoke cleanse 07:51 reiki symbols 09:49 cleansing sweeps 10:55 scooping

Dhiyanoiseasmr

ASMR REIKI manifest love while you sleep ?chakra balancing, binaural beats, hand movements, whisper

ASMR REIKI attract and manifest love while you sleep ? heart chakra healing, binaural beats 7.83 Hz, guided visualisation, hand movements, energy healing & activation, whispered chakra balancing, finger flutters 00:00 intro 03:16 incense smoke cleanse

Dhiyanoiseasmr

ASMR REIKI drawing & tracing reiki symbols on chakras for sleep | hand movements, balancing chakras

ASMR REIKI drawing & tracing reiki symbols on your chakras for sleep | hand movements, chakra balancing & healing energy 00:00 intro 01:11 introducing the reiki symbols 02:16 cho ku rei 04:11 sei he ki 06:39 hon sha ze sho nen 09:31 reiki symbol sandwich

Dhiyanoiseasmr

The Velvet Whisperer ASMR

Subs(26000) Views(2391434)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Story Time / Recap / Up Close - like, real close, lol

Let's get into this story time / recap of the last two videos! Headphones, please :-) Comment, like, share, subscribe, and turn on notifications! ;-) "Tip Jar" (If you feel inspired - any donation is greatly appreciated!) Venmo: @mikewb or CashApp: $Mike

Dhiyanoiseasmr

Come get FITTED on the UNDERGROUND MARKET | ASMR Role Play

Velvet gang! Grab those headphones and join me in this dark room so you can get your fitting :-D Comment, like, share, subscribe, and turn on notifications! ;-) "Tip Jar" (If you feel inspired - any donation is greatly appreciated!) Venmo: @mikewb or Ca

Dhiyanoiseasmr

ASMR Roleplay: Physical Exam on the Black Market

Velvet gang! In the previous video (https://youtu.be/9cDb6cJWMdA), you were interviewed to gain access into the Black Market Gym. You were informed you needed a physical to complete your admission process. Here we are :) Grab those headphones! Comment, li

Dhiyanoiseasmr

Ana ASMR

Subs(7120) Views(491607)

Last Update (07/2021)

Dhiyanoiseasmr

99,99% I swear you will tingle. Mastered audio. Inspired by SensorAdi ASMR (AGS, Echo)

Finaly 99,99 tingles. Inspired by SensorAdi ASMR. Like AGS (Asmr godlike style) Link SensorAdi channel : https://youtube.com/c/SensorAdiASMR I hope you enjoy it! ?Do not forget to subscribe ! And activate the bell, this way you will be noticed when

Dhiyanoiseasmr

Terapie pentru relaxare si dormire. Terapeuta doctor roleplay. ASMR in romana(relaxing therapy)

Terapeuta doctor roleplay in limba romana. Terapie pentru, stres, relaxare si dormire. Sper sa va placa și sa va relaxeze ? Daca esti pentru prima data pe canalul meu și nu ști ce înseamnă asmr, cauta pe google. Dacă ai întrebări Uite-te la vi

Dhiyanoiseasmr

ASMR Sunete relaxante cu CominAsmr. Adormi in 10 minute ?

Videoclip colaborare?. Sunete relaxante, mouth sounds, trigger word. A 2a parte a videoclipului pe canalul lui cominASMR: https://youtu.be/RBODf8KtE7A Canalul lui CominASMR https://www.youtube.com/channel/UCMZI3-oK7bmcM0xb1I3xjXA Sper sa va placa și

Dhiyanoiseasmr

River ASMR

Subs(58100) Views(7241891)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ⛵Captain Takes Care Of You

? Go to https://surfshark.deals/RIVER enter promo code RIVER for 83% off and get 3 months totally free. Trigger Menu 00:00 Surfshark tingles prelude 01:07 show begins 02:00 serves liquid refreshment 03:55 magnifying glass 04:30 tending to graze 05:05 w

Dhiyanoiseasmr

ASMR Skincare Beautician Treatment [Cleanse, Face Scrub, Cream, Massage]

Use the code RIVER to get 25% off - see pinned comment! 00:00 Beauty Consultant Overview 03:30 Inspection 04:30 Creamy Charcoal Cleanser with Chamomile Extract 06:00 Sample Slice 06:40 Apply Cleanser 11:35 Facial Scrub with Eucalyptus 14:15 Sample Slice 1

Dhiyanoiseasmr

Best Budget Selfie Light 2021? Enhance your Beauty!? TONOR TRL-20 12'' Ring Light with Tripod Stand

UK ?? https://amzn.to/2QPQ1S5 (10% discount code: RiverTonor) US ?? https://amzn.to/37AQygl (20% discount code : Ringlight2) ? Tonor Website: https://www.tonormic.com/collections/ring-light For transparency, please note that I've never us

Dhiyanoiseasmr

angel ASMR

Subs(12800) Views(1043386)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - True Crime - The Disappearance of Don Lewis

Thank you so much to HelloFresh for sponsoring todays video! : ) Use code ANGELASMR12 to get up to 12 FREE MEALS across your first 4 HelloFresh boxes, including free shipping on your first box at https://bit.ly/3sGxp56! Welcome back to my channel for

Dhiyanoiseasmr

ASMR - True Crime - Harold Shipman

Welcome back to my channel for yet another wine and crime night! Tonights story is the tale of the evil Dr Death, Harold Shipman. United Kingdom family doctor turned murderer, targeting older women in his small town. Watch todays video for this and much mo

Dhiyanoiseasmr

ASMR - True Crime - Albert Fish

Welcome back to my channel for yet another wine and crime night! Tonights story is the tale of the horrific man, Albert Fish. American serial killer, child rapist, cannibal, and monster. Watch todays video for this and much more. Please like and subscrib

Dhiyanoiseasmr

Zephyr Whispers ASMR

Subs(1970) Views(47739)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Coding at Work

Hi everyone ? join me as I work at my desk for some nice keyboard sounds and ambience - I am actually at work so probably won't be able to respond to messages but I'll leave live chat on!

Dhiyanoiseasmr

ASMR - Working at my Computer as a Coder | ASMR Typing Sounds

Hi everyone ? join me as I work at my desk for some nice keyboard sounds and ambience - I am actually at work so probably won't be able to respond to messages but I'll leave live chat on!

Dhiyanoiseasmr

ASMR - Working Live! | ASMR Typing Sounds

Hi everyone ? join me as I work at my desk for some nice keyboard sounds and ambience - I am actually at work so probably won't be able to respond to messages but I'll leave live chat on!

Dhiyanoiseasmr

Luckily ASMR

Subs(796) Views(46626)

Last Update (07/2021)

Dhiyanoiseasmr

〘ASMR〙 Soft Singing Hit Songs for a Melodic Sleep

A soft singing ASMR video with some of my favorite recent songs from Olivia Rodrigo, Ava Max, Ed Sheeran, Lukas Graham... The singing should be top notch but not loud and definitely good for sleep! 〔 If you like the video consider leaving a like/commen

Dhiyanoiseasmr

Channel Update! - New Videos Coming

An update video where I explain where I'm at right now, the new upload schedule and how free I'll be in the future. Lots of good news in this one guys! 〔 If you like the video consider leaving a like/comment and subscribing for more ASMR! 〕 I won't c

Dhiyanoiseasmr

〘ASMR〙 Whisper-ranking My Favorite "The Walking Dead" Seasons (1-8)

A whispering ASMR video where I talk about my favorite The Walking Dead seasons (that I have watched). *Spoiler Warning for the first 8 seasons* 〔 If you like the video consider leaving a like/comment and subscribing for more ASMR! 〕 I unfortunately

Dhiyanoiseasmr

LifeWordASMR

Subs(6040) Views(493672)

Last Update (07/2021)

Dhiyanoiseasmr

How to respond when you’re caught off guard | Christian Lifestyle | Relaxing Devotion

Have you ever been caught off guard in an uncomfortable situation and weren't sure how to immediately respond? Here is a blanket response to the fiery darts the enemy sends your way to knock you off track in your everyday Christian life. Rela

Dhiyanoiseasmr

Channel update - See you soon!

Quick update - not a drastic change, just some focus on bible study, deep discussion, & relaxing Christian talk. Love & miss you all! Christian ASMR

Dhiyanoiseasmr

CHILL OUT Together & Sleepy Bible Meditation ? Rainy Day Christian ASMR ? Whispers, Thunder, & Taps

Let's chill out together on this rainy spring afternoon and meditate on some scripture passages. 100% authentic full thunderstorm sequence! Whispers, leather tapping, thunder and rain. Perfect to relax or fall asleep while enjoying the company of a Christi

Dhiyanoiseasmr

Johnn ASMR

Subs(19500) Views(1435205)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR SLEEP CLINIC ROLEPLAY (FULL EXAMINATION)

ASMR SLEEP CLINIC ROLEPLAY (FULL EXAMINATION) FOLLOW ME ON INSTAGRAM TO STAY CONNECTED: https://www.instagram.com/frjohnn/​​​​ FOLLOW ME ON TWITCH FOR EVERYDAY LIVE STREAMS : https://www.twitch.tv/johnnasmr JOIN THE ASMR COMMUNITY DISCORD HERE:

Dhiyanoiseasmr

ASMR EXAMEN DE NERVIOS CRANEALES RÁPIDO EN 1 MINUTO | ASMR EN ESPAÑOL

¿ESTÁ LISTO PARA SU REVISIÓN? ASMR RÁPIDO EXAMEN DE NERVIOS CRANEALES EN 1 MINUTO | ASMR EN ESPAÑOL ¡USTEDES SON LA MEJOR Y MÁS COMUNIDAD DE APOYO! Estoy contento de poder ayudar a todos a dormir y sentir asmr :) SÍGUEME EN INSTAGRAM PARA MANTEN

Dhiyanoiseasmr

ASMR | MY SUBSCRIBERS PICK THE TRIGGER (AIR TRACING, INAUDIBLE WHISPERS, HAND MOVEMENTS)

ASMR DOING YOUR FAV TRIGGERS (AIR TRACING, INAUDIBLE WHISPERS, HAND MOVEMENTS) Timestamp: 0:00 - INTRO (CATCHING UP WITH YOU ALL) 2:07 - AIR TRACING TRIGGER 5:30 - INAUDIBLE WHISPERING 7:15 - FOLLOW THE LIGHT TRIGGER 8:58 - WRITING SOUNDS (PENCIL) 11:10 -

Dhiyanoiseasmr

Violet Day

Subs(1950) Views(231254)

Last Update (07/2021)

Dhiyanoiseasmr

[ ASMR n°70 ] Whispered SPA Facial Cleanse Roleplay (W/ Relaxing Music)

LONGER VIDEOS ARE BACK! Hi! Welcome back. In this video, you'll be relaxed and pampered by Amelia. She's the best of the best at the salon, and you wanted to book a much longer appointment with her to feel relaxed. Luckily, she can do just that for you!

Dhiyanoiseasmr

[ ASMR n°69 ] : ~Cozy~ Makeover By Your Older Sister. *Part 1* (Short ASMR)

Today, you'll be visted by your older sister Violet- who you've come to for a quick, and simple makeup look. :D She's (almost always) late for work, so she can spare a few extra minutes to help you get that look you were going for! Enjoy. x (OPEN ME!) ~~~~

Dhiyanoiseasmr

[ ASMR n°68 ] : Casual Whispered Tapping & Rambling (Quick Tingles)

Whoa, she's back again? Indeed I am. :D After two long months, this weirdo is back in action for more *frequent* uploads. I apologize for the delay! Know it's been a bit. Anyway- today would've been a typical 19-20 minute video, but my camera decided to c

Dhiyanoiseasmr

Loadiy ASMR

Subs(162000) Views(14597018)

Last Update (07/2021)

Dhiyanoiseasmr

너의 미래를 읽어주는 친구 ASMR

안녕하세요~ 로디입니다! 오랜만에 친구 시리즈로 영상을 제작했습니다 처음에는 그럴듯하지만 갈수록 서툰 스멜이 나네요 ..ㅋㅋㅋㅋ 갑자기 컨셉이 왜 이렇게 되는건지.. 오랜만에 판타지 ??

Dhiyanoiseasmr

[ ASMR ] 조용한 귀 마사지 Ear massage

* 이어폰을 착용하고 들어주세요 * 안녕하세요 로디입니다 :) 많이 늦었습니다 죄송합니다 기다려주신분들 감사합니다 좋은 영상으로 보답하겠습니다 ㅠㅠ.. 즐감하시고 좋은 밤 되시길 바랍

Dhiyanoiseasmr

ささやく 日本語の単語の繰り返しASMR 속삭이는 일본어 단어 반복

こんにちは。Loadiyです。 日本の皆さんが私の映像をたくさん見てくださるのを知ってます。 それで,つまらないプレゼントを準備しました。 日本語の実力がすごく足りなくてぎこちない点??

Dhiyanoiseasmr

Binaural Eats ASMR

Subs(78900) Views(14350201)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR: AMISH BREAKFAST CASSEROLE (EATING SOUNDS) STORYTIME~SOFT SPOKEN

Hi everyone. In this ASMR video I'm eating a delicious Amish Breakfast Casserole that my wife made for me. I also tell a story about my dad and some of the cool things that I have of his. I hope you like it. Sit back, relax and enjoy the video. Sleep well

Dhiyanoiseasmr

ASMR: ALL NEW~RELAXING SOLITAIRE/EATING CHEWY CANDY~SOFT SPOKEN/WHISPER

Hi everyone. Join me in this ASMR video for a few games of Solitaire. Hopefully I can win a game or two. As always I'll be eating a variety of chewy candy while I play the games. I'm having Swedish Fish, Starburst Fruit Chews and Hi-Chew candy. Sit back, r

Dhiyanoiseasmr

ASMR: OIKOS GREEK YOGURT WITH CRUNCHY APPLES AND ALMONDS (EATING SOUNDS) SOFT SPOKEN

Hi everyone. In this ASMR video I'm having a delicious healthy snack for lunch. I'm eating some Oikos Greek Yogurt with crunchy apples and almonds. I hope you like it. Sit back, relax and enjoy the video. Sleep well my friends. Please like, comment and su

Dhiyanoiseasmr

ChakraBot

Subs(8000) Views(989179)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR: Fabric massage and whisper

Use headphones. ~~~Enjoy~~~

Dhiyanoiseasmr

ASMR: Dry flowers (crinkling, glass tapping, brushing)

The crinkluing is sort of loud through headphones, so listen through speakers first to judge whether or not you want to use them.

Dhiyanoiseasmr

ASMR: Lush catalogue- Page flipping/soft spoken

I haven't uploaded anything other than readings in too long! Here I am going through a Lush catalogue and talking about my choices, or reading their descriptions. A nice long video for you all.

Dhiyanoiseasmr

kkybik ASMR

Subs(3860) Views(689290)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Boyfriend Roleplay // sign language

Girls, next time lets try to be more peaceful in nervous situation with your boyfriend. This ASMR role play special for you! https://vk.com/m.novelisky - я ВК https://www.instagram.com/novelisky/ - инстаграм

Dhiyanoiseasmr

АСМР мешок для удовольствий!

Я нашел эту небольшую сумку с разными предметами для АСМР... давайте заглянем? https://vk.com/m.novelisky - я ВК https://www.instagram.com/novelisky/ - инстаграм

Dhiyanoiseasmr

Новогодний АСМР!!! Новогодняя АСМР ночь.

Дорогие друзья! Поздравляю Вас с 2017 годом. Желаю всего самого наилучшего. Любите и проявляйте заботу друг к другу - в этом смысл жизни. Спасиб

Dhiyanoiseasmr

ASMRSurge

Subs(789000) Views(188070099)

Last Update (07/2021)

Dhiyanoiseasmr

Let's pack, go, and relax in the middle of nowhere

“Keep close to Nature’s heart… and break clear away, once in awhile, and climb a mountain or spend a week in the woods. Wash your spirit clean.” Full length footage of each trip without music can be seen here:https://www.youtube.com/channel/UCaKFZ

Dhiyanoiseasmr

ASMR Very satisfying ink grinding session

Hello everyone, Back in 2014 I saw a YouTube video made by yanghaiying in which she grinded some ink. I loved it so much that it is still one of my go-to ASMR videos. I use it very often when I need to unwind. It hasn't ceased to give me tingles even afte

Dhiyanoiseasmr

ASMR Close-up relaxing bonanza 2

Hi there, I hope you are doing great guys :) Here is another video with some random items found in one of my magic black boxes. Enjoy! Microphones that I use: https://binauralenthusiast.com/

Dhiyanoiseasmr

ASMR Only

Subs(2380) Views(118717)

Last Update (07/2021)

Dhiyanoiseasmr

*ASMR* DEEP & INTENSE Experimental Triggers to make you TINGLE & SLEEP ? (NO TALKING)

Who doesn't like some ASMR Deep and Unique Experimental triggers.? In today's video, i have some unique and experimental triggers to make you tingle down your spine. Some of these triggers include intense tapping, scratching, vigorous sounds. While there a

Dhiyanoiseasmr

*ASMR* EXTREME SPICY FIRE NOODLES (No Talking) EATING SOUNDS

ASMR EXTREME SPICY FIRE NOODLES (No Talking) EATING SOUNDS. i sweat a lot. lol ***If you do not enjoy EATING SOUNDS, DO NOT WATCH. *** What is ASMR? Autonomous Sensory Meridian Response is an experience characterized by a static-like or tingling sensati

Dhiyanoiseasmr

Asmr - Mouth Sounds gone SXXUAL ? (Mic Nibbling/ licking, Kissing, Deep breathing Sounds)

Asmr intense Mouth Sounds gone Sexual. Get ready to cringe while relaxing at the same time haha. Previously: Asmr for people who don't get Tingles https://goo.gl/mgJrnG #Asmr #MouthSounds #intense

Dhiyanoiseasmr

ASMR DOLL

Subs(145000) Views(23292353)

Last Update (07/2021)

Dhiyanoiseasmr

ZAFUL Summer/Beach Inspired TRY ON HAUL (Close-Up Whispering, Inaudible Mouth/Fabric Sounds)

ONLYFANS: https://onlyfans.com/onlysaba Shop ZAFUL’s 7th Year Anniversary Sale: http://fshion.me/302DWKY USE DISCOUNT CODE “DOLL18” FOR 18% OFF YOUR NEXT PURCHASE ♡ Criss Cross Wrap Crop Top (one size): http://fshion.me/302EljB ♡ Solid Color

Dhiyanoiseasmr

ASMR | Hair brushing / Styling & Life Update! (Tapping, Hand Movements, Rambling)

ONLYFANS: https://onlyfans.com/onlysaba Duvolle® 70% OFF PROMO CODE: ASMRDOLL70 Duvolle® Desire Series Styling Iron: $28.50 https://duvolle.com/desire-series-styling-iron/ ? INSTAGRAM: https://bit.ly/3kTsZmo ? BUSINESS INQUIRIES: asmrsaba@gmail.co

Dhiyanoiseasmr

ASMR | Sneakers Collection (Softly Spoken / Whispered)

☁️ My Patreon is paused for the next few months while I finish school. Working full time and studying is not easy, so thank you for being patient with me! I hope you're healthy and well, dolls. Xo ? INSTAGRAM: https://bit.ly/3kTsZmo ? BUSINESS I

Dhiyanoiseasmr

Bible ASMR

Subs(543) Views(10044)

Last Update (07/2021)

Dhiyanoiseasmr

Bible ASMR Exodus 25-28ㅣIs God being Fussy?

Hey guys it's good to be back! Thank you for all of your messages I like reading them in my spare time on the train or at home! We are reading a long section of descriptive words about the Tabernacle. I think it helps to have a picture of it as we read so

Dhiyanoiseasmr

Bible ASMR Exodus 20-24 l Normal Reading/10 commandments/What does God want?

Hello everyone! the weather in London is improving but I've been feeling lazy recently. I went to the post office today to send off documents for the GDC application (dental governing body in UK). I have also been binging "How I met your mother" which is

Dhiyanoiseasmr

Update from 30 June 2021

Hello all! It feels good to communicate with you guys again. In this video I highlight what has been going on in my life. I also shout out your lovely comments! Hope you have a wonderful week and see you all soon!

Dhiyanoiseasmr

Orenda ASMR

Subs(160000) Views(19949624)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] French Maid Gives You the Most Personal Attention You've Ever Had (Role Play)

Social media: There's a much better version of this video on my 0nlyfans:@orenda https://www.instagram.com/theorenda_ https://www.twitter.com/orendasfs https://www.facebook.com/orendaasmr If you are not interested in my Only Fans page but want to su

Dhiyanoiseasmr

[ASMR] LOVE IS THAT TINGLE French Girlfriend Role Play Whispering Sweet Nothings

Social media: There's an extended version of this video on my 0nlyfans:@orenda https://www.instagram.com/theorenda_ https://www.twitter.com/orendasfs https://www.facebook.com/orendaasmr If you are not interested in my Only Fans page but want to supp

Dhiyanoiseasmr

[ASMR] Breathy Kisses ? & Brain Massage (Mic Scratching)

Social media: Find an extended version of this video on my 0nlyfans:@orenda https://www.instagram.com/theorenda_ https://www.twitter.com/orendasfs https://www.facebook.com/orendaasmr If you are not interested in my Only Fans page but want to support

Dhiyanoiseasmr

Kali Cakes ASMR

Subs(1810) Views(106959)

Last Update (07/2021)

Dhiyanoiseasmr

FABLETICS ASMR TRY ON HAUL

Lots of crinkles and fabric scratching!! Check out my other socials: https://linktr.ee/kalicakesxo

Dhiyanoiseasmr

Random trigger ASMR

Lots of random triggers! Check out my other socials: https://linktr.ee/kalicakesxo

Dhiyanoiseasmr

Slime ASMR

Another new concept im trying! I liked some of the sounds i found so i will be making another video like this! Comment what you like/dont like Check out my other socials: https://Linktr.ee/kalicakesxo

Dhiyanoiseasmr

ZenCatto ASMR

Subs(522) Views(72700)

Last Update (07/2021)

Dhiyanoiseasmr

? ASMR Sea of Thieves - Relaxed Gameplay & Gold Hoarder Voyage (Whisper/Soft Speaking) ?

#GamingASMR #SeaOfThieves #RelaxingGameplay Hey there ? welcome to the 3rd Sea of Thieves ASMR video! If you haven't checked out the first two, take a look (you might enjoy them ?) SOT 1 (chill gaming): https://youtu.be/8dmF-SR63D4 SOT 2 (thunderst

Dhiyanoiseasmr

Sound Bath for Shavasana | 15 Minute Meditation Music | ASMR Singing Bowls Relaxation

#Meditation #ZenCatto #SingingBowls Hello & welcome! Raise your vibration with this video. Sit or lay down and relax for a Shavasana. You can also use this for a 15 minute unguided meditation or general relaxation if you'd like! ? I personally get ASMR

Dhiyanoiseasmr

Crystal Singing Bowl Compilation ? Sound Bath [ Meditation | Sleep Music | ASMR ]

#Meditation #ZenCatto #SingingBowls Crystal Singing Bowls | Himalayan Singing Bowls Here is a crystal singing bowl meditation/relaxation video for your enjoyment! I took some older recordings I had sitting in a folder and combined them into what is (hopefu

Dhiyanoiseasmr

in your ear ASMR

Subs(17100) Views(2212795)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR]많이 덥죠? 물 머금은 솜으로 시원하게 귀 닦고 가세요 ?

?시청료는 '좋아요' 와 '구독' 으로 부탁드려요?? 안녕하세요 여러분 유어입니다:) 오늘은 여름특집으로 시원하게 물을 이용한 귀 터칭을 준비해봤습니다. 쪼르르 물소리와 촉촉하게 머??

Dhiyanoiseasmr

[ASMR]고막 팅글 제대로 느껴보실래요? 퍼프 마이크 터칭 Puff Mic Touching

?시청료는 '좋아요' 와 '구독' 으로 부탁드려요?? ?이어폰 착용 필수 ?볼륨 조절 필수 ?마이크 : Zoom H6 ?카메라 : 캐논 g7x mark2 ✂️편집 : 프리미어(색보정) 안녕하세요 유어입니

Dhiyanoiseasmr

[ASMR]잠이 솔솔 고막 간질 라텍스 장갑 끼고 마이크 터칭???

?시청료는 '좋아요' 와 '구독' 으로 부탁드려요?? ?이어폰 착용 필수 ?볼륨 조절 필수 ?마이크 : Zoom H6 ?카메라 : 캐논 g7x mark2 ✂️편집 : 프리미어(색보정) 안녕하세요 유어입니?

Dhiyanoiseasmr

Noah asmr

Subs() Views(3854515)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Daily Makeup Routine☘️✨(with Chit Chat)

Eng sub ⭕️ #My #Makeup #Tutorial ?Instagram : @noahofzzzion ?Tik Tok : @noahofzzzion

Dhiyanoiseasmr

ASMR Realistic Makeup?I'll apply makeup on the camera RP(No talking)❤

? Instagram : @noahofzzzion ? TikTok : @noahofzzzion #Realistic #Makeup #Roleplay

Dhiyanoiseasmr

ASMR "What? You fought 50 to 1?" Bad student Treating your wounds RP

Eng sub⭕ ? Instagram : @noahofzzzion ? TikTok : @noahofzzzion #Friend #Roleplay #Realistic

Dhiyanoiseasmr

Mixed ASMR

Subs(55600) Views(9037173)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Good morning! Breakfast time!

Dhiyanoiseasmr

ASMR Stream- This time YOU tuck ME in

Dhiyanoiseasmr

ASMR I am very small and I have no money

Dhiyanoiseasmr

Dr Bobby ASMR

Subs(3070) Views(63582)

Last Update (07/2021)

Dhiyanoiseasmr

Dr Bobby ASMR: Beard Sounds.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find these beard sounds relaxing. * disclaimer - I thoroughly washed my hands and face prior to, and immediately following, this video, in addition to using alcohol gel! Very

Dhiyanoiseasmr

Dr Bobby ASMR: Multilayered Sounds Compilation.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find this multilayered sounds compilation relaxing. In this video you get four Bobby's for the price of one ... I'm hoping that's a good thing ... ;) This compilation was made

Dhiyanoiseasmr

Dr Bobby ASMR: Negative Energy Plucking.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find this negative energy plucking relaxing. I think we all deserve to connect with a sense of peace during these difficult times! :) Ps. You're all amazing. Stay safe. x *-*

Dhiyanoiseasmr

[ASMR]nara_나라

Subs(536000) Views(77090616)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR(Sub✔)어딘가 어설픈 고막 치료사 상황극/듣다 보면 아침? Strange Ear Therapist Helps You Sleep

안녕하세요 여러분 ❤ 오늘은 컨셉에 충실한 엉터리 고막 치료 상황극입니다:) 영상 보시고 오늘밤도 푹 주무시길 바랄게요 굿나잇? ?메이크업 및 의상 정보? 렌즈 : 루나뷰 - 코코아 브

Dhiyanoiseasmr

ASMR(Sub✔) 잠을 잘 자게 해줄 뇌신경 검사 상황극 Cranial Nerve Exam RP

안녕하세요 여러분 ❤ 이제 더운 날씨가 계속 될 거 같아요 날씨에 맞춰 앞머리를 시원하게 기르고 있는데 어떤 가용? 사실 앞머리를 완벽하게 길러본 적이 없어 어떤 모습일지 궁금합니다ㅎ??

Dhiyanoiseasmr

ASMR(Sub✔)편안한 속눈썹 펌 받으면서 잘자요 Good night while getting comfortable eyelash perm care.

안녕하세요 여러분 ❤ 오늘은 휴식기간이 끝나고 올리는 첫 영상인데요! 복귀 영상이라 생각하니 조금 떨리기도 하네요 잘 쉬고 돌아온 만큼 다시 열심히 영상 제작에 집중하도록 할게요 와주

Dhiyanoiseasmr

ASMR 도령도령

Subs(1080) Views(73115)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 자기 전에 귀 파드립니다/??? 시각적 귀파기 상황극/귀청소 가게 롤플레이/Ear cleaning rol

안녕하세요 여러분 오늘은 시각적 귀청소 가게 영상을 찍어 봤습니다 배경조명을 새로 바꿔 봤는데 맘에 드시는지 궁금합니다! 그리고 업로드 날짜를 수요일과 토요일로 정할까 합니다 오늘도

Dhiyanoiseasmr

ASMR 팅글 오는 귀청소 해드릴게요/귀파기 양쪽 강하게 no talking /면봉,핀셋,가위

안녕하세요 여러분 오늘은 강하고 자극적인 no talking 귀파기 영상을 찍어봤습니다 최근에 조명을 하나 더 샀는데 색깔이 엄청 여러개 나오거든요? 배경 색깔을 조금 바꾸고 싶어서 산건데 결국 ?

Dhiyanoiseasmr

ASMR 화장이 서툰 손님, 상담가득한 메이크업샵 /롤플레이 후시녹음/make up asmr roleplay sub_

안녕하세요 여러분 오늘은 상담+키보드 소리+메이크업 영상입니다 롤플레이 영상은 찍을 때 마다 재밌는 거 같네요 아직 연기가 어색하긴 하지만..^^ 영상 요청해 주신 분! 마음에 드셨으면 좋겠

Dhiyanoiseasmr

Fantastical ASMR

Subs(8980) Views(1074880)

Last Update (07/2021)

Dhiyanoiseasmr

Werewolf Wants To Be Friends Pt. 2 ASMR Roleplay | (M4A)

Friend! You came back, friend! Let's go hunting! He's back by popular demand! I had a lot of fun making this, so there's definitely going to be a series for this cute pup! More insanity and randomness: https://twitter.com/AsmrFantastical Patreon for e

Dhiyanoiseasmr

Moonlit Dance With Your Boyfriend ASMR Roleplay | (M4F)

Oh, darling..... Are we almost ready to go dancing? I can't wait to hold you in my arms.... This script idea was provided by Aki. Thank you so much for the idea! Hope you enjoy! Song from bensounds.com More insanity and randomness: https://twitter.com/A

Dhiyanoiseasmr

Caretaking A Haunted Mansion Ghost In The Mirror ASMR Roleplay | M4A

TW: Mention of self harm, suicide, and verbal abuse. Meet the ghost in the mirror. He claims he knows everything about you, but what do you think? Maybe he know you better than you know yourself..... More insanity and randomness: https://twitter.com/Asmr

Dhiyanoiseasmr

Reiki Kisses ASMR

Subs(420) Views(32287)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR #shorts Pick a Fairy Card ??‍♀️

Dhiyanoiseasmr

ASMR ? Match Lighting ? Whispers ?

Hi Lovies ? Here is a requested match lighting video ?? Just to warn you * there are lots of background sounds * ? Wishing for your dreams to be lit up like a flame ;) ? & wrapped around you with warmth and love ? Love and huggles to

Dhiyanoiseasmr

ASMR✨ Follow the chain ?⛓| Soft Spoken | Writing Sounds ?

Hi Sweetest Souls ? I don’t really know what I’m doing in this little video ??‍♀️⛓? but thanks for helping me out ? & hope you find it soothing :p?? Love you always x o x ? Email me at ➡️ ? reikikisses@gmail.

Dhiyanoiseasmr

DuckMarbles ASMR

Subs(2310) Views(155667)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Medical Roleplay- Nervous and Tired Nurse Helps On His First Day

I wanted to switch things up and do something a little bit different than the regular medical videos I do! I left a poll to decide between this or a comfort video, so next week will be some comfort ASMR! Also please excuse the sunbirn...it kinda looks lik

Dhiyanoiseasmr

When You Try To Make A Video, But Get Distracted

I sat down to make a video and....well.....I got side tracked....

Dhiyanoiseasmr

ASMR Barber Roleplay- Giving You A Haircut (with background storm sounds)

snip snipsnip snipsnipsnip snipsnipsnipsnip snipsnipsnipsnipsnip snipsnipsnipsnipsnipsnip snipsnipiloveyousnipsnipsnip snipsnipyouresuchacutiesnipsnip snipsnipsnipwinkyfacesnipsnipsnipsnip __________________________________________________ If you enjoy

Dhiyanoiseasmr

Mango ASMR

Subs(135) Views(11440)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Pop It Sounds ? | Soft Spoken

Hello everyone!! It is Mango ASMR! Welcome to my channel :) In this video, l filmed a video with push pop. I hope you that you have a great day and thank you for watching my video :) - Donation https://toon.at/donate/637290160258925718 (Thank you for you

Dhiyanoiseasmr

[ASMR] Keyboard Typing Sound ⌨ | Typing , Clicking , No Talking

Hello everyone!!! It's Mango ASMR. It's very very long time no see. I'm so so sorry about that and thank you for waiting my videos ? Actually l had very important exams.. So, l couldn't upload new videos. I'm so sorry about that? But finally l finish

Dhiyanoiseasmr

[ASMR] Doing My Skincare ?? | My Skincare Routine | Soft Spoken

Hello everyone!! It is Mango ASMR :) Today l will do my skincare. So, l hope you have a peaceful time through this video! Thank you always. - Donation https://toon.at/donate/637290160258925718 (Thank you for your support?) - Song : Arms of Heaven - A

Dhiyanoiseasmr

CURIE. ASMR

Subs(52600) Views(14015447)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR MINT CHOC CHIP ICE CREAM, OREO,CINNAMON ROLL eating sound |민트초코칩아이스크림,시나몬롤 먹방|CURIE.ASMR

?Aloha, Today, I’m eating Mint chocolate chip ice cream, fudge covered Oreo and cinnamon roll. ❤️Please Subscribe, Like and Comment. It encourages me a lot. Thank you. 오늘은 민트초코칩 아이스크림, 퍼지커버 오레오, 시나몬

Dhiyanoiseasmr

ASMR COOKIES ’N CREME MOUSE NEAPOLITAN MOUSE eating sound | 쿠키앤크림 무스, 나폴리탄 무스 먹방 리얼사운드

?Aloha, Today, I’m eating Cookies ’N creme mouse, Neapolitan mouse and assorted sweets. ❤️Please Subscribe, Like and Comment. It encourages me a lot. Thank you. 오늘은 쿠키앤크림 무스, 나폴리탄 무스 와 다른 스낵들을 준

Dhiyanoiseasmr

ASMR COOKIES & CREAM BROWNIE, ICE CREAM,KIT KAT eating sound | 쿠키앤크림 브라우니, 아이스크림 먹방 리얼사운

?Aloha, Today, I’m eating Cookies and cream brownies, jamoca almonds fudge ice cream and kit kat. ❤️Please Subscribe, Like and Comment. It encourages me a lot. Thank you. 오늘은 쿠키앤크림 브라우니와 자모카 아몬드 퍼지 아?

Dhiyanoiseasmr

Ayexotic ASMR

Subs(428) Views(29388)

Last Update (07/2021)

Dhiyanoiseasmr

Yellow Sand rocks mixed ASMR Sand pop surprise series #6 dry crumble crispy fine texture

#yellowsand #sandasmr #purecement Welcome to my randomness!? Instagram: https://instagram.com/ayexotic_?igshid=1ads4oni8fc9n WHAT IS ASMR? ASMR is a term used to describe a sensation that people get when they watch certain triggering videos to calm th

Dhiyanoiseasmr

My kid voice ASMR message in rain #shorts

#shorts #asmrshorts Welcome to my randomness!? Instagram: https://instagram.com/ayexotic_?igshid=1ads4oni8fc9n Guys this is done in my kid voice pls dont cringe omg idk why i did this im so extra lmaooo WHAT IS ASMR? ASMR is a term used to describe

Dhiyanoiseasmr

Sand Cement ASMR dry crumble pyramid of mini cylinders

#purecement #sandcement #sandcementasmr Welcome to my randomness!? Instagram: https://instagram.com/ayexotic_?igshid=1ads4oni8fc9n WHAT IS ASMR? ASMR is a term used to describe a sensation that people get when they watch certain triggering videos to c

Dhiyanoiseasmr

North Star ASMR

Subs(1700) Views(212246)

Last Update (07/2021)

Dhiyanoiseasmr

My big return to ASMR!!! ?

This video did NOT go as smoothly as planned. Lol. ?? I ran into a lot of problems during filming including my camera not focusing properly + it overheated several times so this took hours to film, which you’ll see I’m filming during the day & at

Dhiyanoiseasmr

Drinking Wine & Talking Movies? (w/ Emmy Award) ASMR

Synopsis: Showing you guys a REAL Emmy Award while drinking wine & talking about movies! **I uploaded this mainly just for fun, to get drunk & ramble on about movies. Thumbs up if you make it through the whole video!! ? ** I don’t really recommend

Dhiyanoiseasmr

ASMR ~ Bubblegum Mixtape

❤ S U B S C R I B E ❤ This is a re-cut of all my previous bubblegum videos... all the best scenes together in one video. Hope you enjoy!

Dhiyanoiseasmr

HoneySoob ASMR

Subs(1410) Views(182628)

Last Update (07/2021)

Dhiyanoiseasmr

[Requested] Sea Animals Plaster Clay Cracking | Most Satisfying Video | No talking ASMR

Plaster Clay Cracking, ASMR, Clay Cracking ASMR, NoTalking, Oddly Satisfying Video, Most Satisfying Slime Video, Relaxing Video, Clay Cracking Slime Compilation, Slime Video, Slime ASMR, Clay Cracking Slime Video, Relaxing Slime, Relaxing Slime ASMR, Plast

Dhiyanoiseasmr

Slime Coloring with Lipsticks, writing on Slime ! | Satisfying Slime ASMR

Slime Coloring, Makeup Slime Coloring, ASMR, Slime ASMR, NoTalking, Oddly Satisfying Video, Most Satisfying Slime Video, Relaxing Video, Slime Compilation, Slime Video, Slime ASMR, Clay Cracking Slime Video, Relaxing Slime, Relaxing Slime ASMR, Slime messa

Dhiyanoiseasmr

ASMR | Clay Cracking, Clay Slime Mixing, Most Satisfying Video | Clay Slime Compilation #8

Clay Slime Mixing, Slime Coloring, ASMR, Clay Cracking ASMR, NoTalking, Oddly Satisfying Video, Most Satisfying Slime Video, Relaxing Video, Clay Cracking Slime Compilation, Slime Video, Slime ASMR, Clay Cracking Slime Video, Relaxing Slime, Relaxing Slime

Dhiyanoiseasmr

Adora ASMR

Subs(64200) Views(6306809)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Realistic First Person Eyelash Perm RP W/ Layered Sounds (No Talking)

Hello, everyone! I brought a first-person video after a long time. In the last vote, eyelash perm and eyelash extensions were voted first place. Do you remember?? Watching YouTube, I made it exactly the same as the actual eyelash perm. I think it's a

Dhiyanoiseasmr

ASMR Relaxing Hand Massage, Nail Care & Art ? No Talking (Layered Sounds)

Hello ? I finally uploaded a new nail video today. I'll give you a relaxing hand massage, nail care, and nail art? I thought it would take too long to do colorful nail art, so I tried simple white V French nails this time(I usually takes almost two h

Dhiyanoiseasmr

ASMR Doing Your RED Makeup ? No Talking (Semi-Fast & Aggressive, Layered Sounds)

Hello ? Today I'll do your RED makeup with semi-fast & aggressive, Layered Sounds. For your various tastes, we are making videos alternating between fast/tapping videos and slow/no tapping videos. If it is not your taste, plz wait a moment by watching b

Dhiyanoiseasmr

Mr. Blue ASMR

Subs(18800) Views(2105491)

Last Update (07/2021)

Dhiyanoiseasmr

I'm Back! With Some Old School ASMR Triggers

Hi guys! It's been waaaay too long since I posted my last video. It was kinda awkward to record for the first time in months so please forgive me if it sucks! Anyways, it's good to be back! I missed you all. Hope you missed me too lol. Enjoy! And let me kn

Dhiyanoiseasmr

HAVANA... but ASMR

Heey! This song was highly requested so here it is! Enjoy :) Song: Camila Cabello - Havana Stalk me on instagram: ahsnightmare Check out my previous song but asmr: Dua Lipa - New Rules: https://youtu.be/7TOVbWeEC9w Lana Del Rey - Ride: https://youtu.b

Dhiyanoiseasmr

OLD SCHOOL ASMR MOUTH SOUNDS

Tonight's video is an old school ASMR mouth sounds - up close, no professional mic. Hope you gonna enjoy it. Give me some love in the comments if you do! and don't forget to HIT it baby one more time. I mean, the thumb up. Love you. Goodnight. Stalk me on

Dhiyanoiseasmr

Mr.Manly ASMR

Subs(239) Views(26380)

Last Update (07/2021)

Dhiyanoiseasmr

Babysitting The Child

Your Mandalorian neighbor has dropped off his "child" for you to babysit for the evening, but you're not really prepared for such a task. Trying to record more videos but I live in the city in a bit of a noisy neighborhood so it can be a little frustrati

Dhiyanoiseasmr

Let's Play No Man's Sky ASMR

Travel the galaxy with me as I play through some of No Man's Sky while whispering commentary. I'm relatively new to the game and it shows, but I'm enjoying it immensely. Please like or subscribe if you dig the video. Also feel free to comment with any cr

Dhiyanoiseasmr

Dragon Ball Kame House: ASMR Guided Meditation (whispers, beach sounds)

Time for a trip to a favorite beachside retreat. This video will help you to relax, fall asleep, and balance your qi. Listen along and enjoy. Also if you enjoy my content please like the video and subscribe to my channel. More good stuff to come. Sleep w

Dhiyanoiseasmr

Charge ASMR

Subs(1570) Views(78988)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | FASTEST eye exam (SOFT SPOKEN)

We check your eyes faster than the eye can see, here at the FASTEST eye exam. Follow me on Twitch: https://www.twitch.tv/jcharge​​​​​​​​​​​ Twitter: https://twitter.com/JamesCharge Support me directly (NOT required or expected. But

Dhiyanoiseasmr

ASMR | How many sounds can a book make??? (SOFT SPOKEN)

I'm really enjoying these "How Many Sounds" videos. I hope you are too. TIMESTAMPS: 0:00 - Preview 0:27 - Intro 1:35 - Book rubbing 2:10 - Bookmark 2:13 - Tapping on cover 3:57 - Tapping on spine 4:47 - Scratching the cover 6:04 - Scratching the spine 6:4

Dhiyanoiseasmr

ASMR | Fast tapping on random objects (NO TALKING)

I haven't done a no talking vid in a while. So I decided why not make another one? TIMESTAMPS: 0:00 - Intro 0:13 - Gum Box 3:14 - TV Remote 5:25 - Small Fabric Case 7:30 - Red Cup (lid on) 8:20 - Red Cup (lid off) Follow me on Twitch: https://www.twitch.

Dhiyanoiseasmr

Latte ASMR

Subs(1590000) Views(376606324)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Ear, Nose & Throat Examination

Hi everyone! It's Latte :) In this video, I will examine your ear, nose and throat. I hope you enjoy and have a relaxing time♥ P.S. 16:45 you don’t have any ‘fever’ sorry for my mistake! ☺️ Thank you for your support♥ : https://www.patreon.

Dhiyanoiseasmr

Relaxing Face Touching & Whispers For Your Sleep⭐️ ASMR

Hi everyone! It's Latte :) In this video, I will touch your face for your good night sleep! I hope you relax and Thank you so much for watching♥ Thank you for your support♥ : https://www.patreon.com/latteasmr

Dhiyanoiseasmr

ASMR Tingly False Eyelash Shop

Hi everyone! It's Latte :) In this video, I will show you some of false lashes and you will try them on. I hope enjoy it! Thank you so much for watching and have a nice day♥ Thank you for your support♥ : https://www.patreon.com/latteasmr

Dhiyanoiseasmr

ind ASMR & massage

Subs(768) Views(53488)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Foot Massage , Tickle leg hair _ Very relaxing to sleep

Foot Massage , Tickle leg hair _ Very relaxing to sleep

Dhiyanoiseasmr

Very Relaxing Back Massage _ ASMR Tickle Massage by ikwan

Relaxing Back Massage _ ASMR Tickle Massage by ikwan Thank for watching Happy massage Indonesia asmr pijat asmr Pijat Massage asmr

Dhiyanoiseasmr

Very Relaxing Back Massage by ikwan _ ASMR No Talk

Relaxing Back Massage by ikwan _ ASMR No Talk

Dhiyanoiseasmr

Afox ASMR

Subs(12200) Views(1369352)

Last Update (07/2021)

Dhiyanoiseasmr

[日本語 ASMR] Whispering Japanese Trigger Words To Help You Sleep | 言葉繰り返し

Hi! this is my first ever Japanese video and I'm very nervous about sharing my speaking Japanese with you guys.. I know I made a few mistakes in pronouncing some words but I will get better! Triggers: 1 カタ 2 友達 3 ニコ 4 ステキ 5 ドキ?

Dhiyanoiseasmr

[ASMR] Little Q&A Part 2! | Soft Spoken

Thanks for everyone's patience in part 2 ^.^ I have been a little busy so took me a while to find time to edit this part. I will be recording some new roleplays REAL soon which I'm happy about! sleep well xoxox

Dhiyanoiseasmr

[ASMR] Little Q&A! Part 1 | Soft Spoken

I finally got round to doing a q&a which turned out to be rather long so I've split it into two videos. I hope you enjoy and maybe get to know me a little better xox

Dhiyanoiseasmr

Zeri ASMR

Subs(39100) Views(4636452)

Last Update (07/2021)

Dhiyanoiseasmr

BRUSHING #SHORTS | Zeri ASMR

Dhiyanoiseasmr

EXAMEN DE LOS NERVIOS CRANEALES | SOFT SPOKEN | ROLEPLAY MÉDICO | ASMR Español

¡Hola! Bienvenido a mi canal, yo soy Lorena Zeri y aquí hago ASMR, si te gusta recuerda que puedes suscribirte y darle like? Mis redes sociales: Twitter: @lorenazeri https://twitter.com/lorenazeri Instagram: @lalorenazeri https://www.instagram.com/

Dhiyanoiseasmr

DEJO EL ASMR PARA SER LA CUARTA POLINESIA

¡Hola! Bienvenido a mi canal, yo soy Lorena Zeri y aquí hago ASMR, si te gusta recuerda que puedes suscribirte y darle like? Mis redes sociales: Twitter: @lorenazeri https://twitter.com/lorenazeri Instagram: @lalorenazeri https://www.instagram.com/

Dhiyanoiseasmr

ocalymaASMR

Subs(7270) Views(1014582)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Soft-Spoken/Whisper Rambling, Brushing (Test Video)

I'm trying to ease my way back into contributing to the ASMR community! Apologies for the unrefined editing (still getting used to a new program). #nervous

Dhiyanoiseasmr

3D ASMR ~ Gentle Tapping and Tracing the Microphone

***HEADPHONES HIGHLY RECOMMENDED*** Hey hey! It's been awhile, I know. I mentioned it on my Facebook, but my uploads will be slowing down while I'm in school. But don't think I've forgotten about you! This is a shorter than normal video. My dog was real

Dhiyanoiseasmr

~ASMR~ Soft-Spoken Organic Chemistry Tutor Role Play

Hola! This is a tutoring role play for you guys. Just FYI, I didn't fact check anything I said in this video, I just did it all from memory. So just to be safe, don't use this as an educational resource. It's only meant for relaxation. There is a small s

Dhiyanoiseasmr

POP ASMR

Subs(693) Views(58816)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR PLANET EARTH GUMMY, SOCCER BASKETBALL TENNIS BASEBALL GUMMY MUKBANG 지구젤리 운동공젤리 먹방 EATING SOUNDS

Welcome to POP ASMR ? Today I prepared special gummy shipped from Korea. They taste awesome! Hope you guys enjoy. Menu: 1. Planet Earth Gummy 2. Eyeball Gummy 3. Soccer Ball Gummy 4. Baseball Gummy 5. Tennis Ball Gummy 6. Basketball Gummy

Dhiyanoiseasmr

ASMR SPECIAL SUSHI ROLLS MUKBANG 스시롤 먹방 COLLAB W @ASABITES ASMR EATING SOUNDS

Welcome to POP ASMR ? Today I prepared special sushi rolls collaborating with @ASABITES ASMR! I hope you guys enjoy!! ?ASABITES ASMR? Video: https://youtu.be/fwtJNM5M32k Channel: https://www.youtube.com/channel/UCpL9lo87r0UhaaJ5-sEbwqQ Menu:

Dhiyanoiseasmr

ASMR MCDONALDS BURGER & CHICKEN NUGGETS MUKBANG 맥도날드 버거 치킨너겟 먹방 COLLAB W @INSECURE LIZ EATING SOUNDS

Welcome to POP ASMR ? Today, I'm collaborating with @Insecure Liz! We will be eating McDonalds today and I hope you enjoy! ?Insecure Liz ? Video: https://youtu.be/RfDzOwxXmxM Channel: https://www.youtube.com/channel/UCIuOe3BaNXj35cbhpxJ0vpA Me

Dhiyanoiseasmr

브리스 Bris ASMR

Subs() Views(21820)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ? 레몬 챌린지 함께 합니다! LEMON challenge (No Talking Mukbang)

#eatingshow, #eatingsound, #Realsound 오늘은 레몬 챌린지에 도전해 보았어요~^^ 어려운 시기, 힘들지만 모두 파이팅 하시고 잘 이겨내는 대한민국 되기를 응원해요 :) ASMR 엄마는 푸라닭을 먹는다 PURADAK

Dhiyanoiseasmr

ASMR ? ? 육아스트레스 뽀개기 #1) 엄마는 푸라닭을 먹는다 PURADAK chicken (No Talking Mukbang)

#eatingshow, #eatingsound, #Realsound 오늘은 야식으로 치킨계의 명품 브랜드‘푸라닭’의 반반 메뉴를 먹어봤어요! 정말 맛 있었어요~ 반반 메뉴 : 블랙 + 악마 18,900원 단품 메뉴 : 악마 치킨 17,900원 ??

Dhiyanoiseasmr

ASMR ? 쥐를 잡자! 찍찍찍! 생쥐 마시멜로 먹방 (Feat. 토크콘서트) ? Mouse marshmallow (No Talking Mukban

#eatingshow, #eatingsound, #Realsound I'll have a cute Mouse marshmallow. 오늘은 귀여운 생쥐 마시멜로우를 먹을게요! 마구 수다를 떠는 한국어 자막을 준비했어요! 한글 자막을 반드시 활성화 시켜주세요~^^ AS

Dhiyanoiseasmr

ASMR Mistress

Subs(1420) Views(187541)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Hairbrushing | Hair Play | Hair over Face PART 2 #asmrhairbrushing #hairtingles

Part 2

Dhiyanoiseasmr

ASMR Hairbrushing | Hair Play | Hair over face Scratching PART 1 #asmrtingles #hairoverface

Hello All I have had to split my video into two parts as I couldn’t upload it as one video It just wouldn’t upload So there is a part 1 and part 2 Please comment and let me know what you think ❤️❤️

Dhiyanoiseasmr

ASMR ~ Brush my hair with me | Hair play

#asmrtingles #asmrhairbrushing #asmrHairplay Hi everyone it’s been a while since I uploaded a hair brushing video but here is one ???

Dhiyanoiseasmr

ASMR with Niamh

Subs(604) Views(25298)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Tapping Empty Things

Hiya lovelies!! Todays video is just lots of tapping on lots of empty things and me whispering along, hope you enjoy :)x I post new videos every Tuesday and Friday at 5:30pm (BST) - please subscribe if you would like to see more! Donations are not expect

Dhiyanoiseasmr

ASMR Lofi - Reading You To Sleep #2 (Soft-Spoken)

Hi lovely people!!! Another reading you to sleep video today with a lofi mic and natural lighting and a mixture of whispers and soft speaking, hope you enjoy :) also I love these stories so much, they remind me of my childhood! let me know what your favour

Dhiyanoiseasmr

ASMR - Useless Facts (Lots Of Whispers)

Hi lovely people!! Hope you enjoy me telling you lots of random useless facts in a nice relaxing whisper?x I post new videos every Tuesday and Friday at 5:30pm (BST) - please subscribe if you would like to see more! Donations are not expected but are

Dhiyanoiseasmr

Moonlight Melodies ASMR

Subs(188) Views(8982)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR No Talking, Mouth Sounds, Mic Scratching

Hello and welcome to Moonlight Melodies ASMR. In this video I will be doing no talking, no talking asmr, asmr, mouth sounds, wet mouth sounds, relaxing, mic, mic scratching, windscreen scratching, intense windscreen scratching, intense mic scratching, face

Dhiyanoiseasmr

ASMR My Journal Collection, Whisper, Tracing, Textures

Hello and welcome to Moonlight Melodies ASMR. In this video I will be showing you my journal collection. There are paper sounds, tracing, scratching, sticky, sticky sounds, sticky fingers, light tapping, whisper, whispering, breathy whisper, texture, textu

Dhiyanoiseasmr

ASMR Hair Sounds, Hair brushing, Foam, Whisper

Hi and welcome to Moonlight Melodies ASMR. In todays video I will be doing hair sounds, hair, hair asmr, crunchy, hair brushing, hair brush, brush, tapping, whisper, gentle whisper, breathy whisper, foam, foam sounds, foam asmr, foam in hair, squishy soun

Dhiyanoiseasmr

FashionEats/ASMR

Subs(158) Views(3902)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR/CHILLI CHEESE HOT DOGS+CRUNCHY TOTS! (Eating sounds) Yummy!

Hey guys!!! Look what we have today! ??? #asmr #mukbang #foodie

Dhiyanoiseasmr

ASMR/CHEESY CHICKEN SPAGHETTI (eating sounds) YUMMY!

Hey guys! Today we have a cheesy chicken spaghetti dinner with green beans and garlic bread! I hope you all enjoy this video! ? ASMR! #ASMR #EATING #FOODIE

Dhiyanoiseasmr

ASMR/SEAFOOD IN B-LOVES SAUCE/ (serious eating sounds) BEWARE!

Hey everyone! Today's ASMR has lots of slurping, gulping and smacking eating sounds! This was so delicious! I hope you all enjoy! Happy Belated Mothers Day to the Mommies! ❤ #ASMR #Seafoodboil #blovessauce

Dhiyanoiseasmr

Scooperdoodle ASMR

Subs(7250) Views(670669)

Last Update (07/2021)

Dhiyanoiseasmr

Kitten Purring ASMR (old school)

Please enjoy the soothing sounds of my cat, Brie, purring

Dhiyanoiseasmr

Old School ASMR Antique Hand Crank Sewing Machine *No Talking* Scooperdoodle ASMR

Hello friends! This video is purely selfish, because I wanted it :) Here is an extended, sewing-only video with my antique 1930’s Hand Crank Singer 99k sewing machine! (I really love this thing)

Dhiyanoiseasmr

Old School ASMR Vintage Hand Crank Sewing Machine Test *No Talking* Scooperdoodle ASMR

Hello all, long time no see! I figured I’d kick off my return with an old school cellphone ASMR video. I don’t have a laptop anymore, so unfortunately this will have to do. In this video I’m making a scrunchie (minus the finishing touches) out of s

Dhiyanoiseasmr

MUNI ASMR 무니

Subs() Views(19061)

Last Update (07/2021)

Dhiyanoiseasmr

[NoTalking]귀청소와 귀마사지 ASMR(EarCleaning&EarMassage),면봉, 스프레이, 알로에, CottonSwab, Spray, Aloe, hand

안녕하세요 무니 입니다 ? ‘핑퐁’ 님께서 쫀득한 소리 요청해주셔서 알로에를 준비해봤는데 원하시는 소리가 맞는 지 모르겠네요 ?? ‘ ㅡ• ‘ 님께서 면봉 ! 요청하셔서 한 번 찍어봤?

Dhiyanoiseasmr

[NoTalking] 3dio 마이크 샀어요 ✨? 3dio 테스트 ASMR (3Dio Mic test ASMR), 귀청소, 귀소독, 귀마사지, 탭??

안녕하세요 무니 입니다 ? 3dio 너무 갖고싶었어욤 ..... ✨? 아니 구독자님들 .. 글쎄 ... 마이크랑 카메라랑 선 연결하면 싱크 맞는다고 하길래 이때까지 그렇게 쓰고 있었는데 이상하게 제 영

Dhiyanoiseasmr

[NoTalking] 4가지 잠이 오는 사물 트리거 (Fast lid sound & tapping 4 Trigger) 스타핑, 뚜껑소리, 탭핑, 팅글,

안녕하세요 무니 입니다 ? 오늘은 네가지 사물 소리 입니다! 이번에 3Dio(귀모양마이크)를 구매했는데 연습 중이에오 .... 다음 영상에는 3Dio로 찾아뵐게요 ! ?TIMELINE PREVIEW 0:00​ ~ 1:44​ 스타

Dhiyanoiseasmr

Camilla ASMR

Subs(861) Views(95788)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Crushing Trample with Heeled Sandals Banana peels Relaxation Sounds

Scusate per le mie assenze ma sono settimane difficili per me e lo saranno sempre di più ma farò il possibile per portare qualche video per voi:) Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi vid

Dhiyanoiseasmr

ASMR My Cat Eating a Meat Stick and Soft Spoken ITA ASMR with My Cat Mia

Oggi video un pò diverso dal solito sarà breve ma vi mostro come do da mangiare uno snack al mio gatto Mia. Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi video :) Per richieste video Custom con d

Dhiyanoiseasmr

ASMR Relaxing Neck & Shoulder Massage Personal Attention Relaxing Massage with Oil

Spero di potervi rilassare con questo delicato massaggio al corpo:) Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi video :) Per richieste video Custom con donazione contattatemi via Email: camilla.a

Dhiyanoiseasmr

LunaRexx ASMR

Subs(162000) Views(20984573)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Black Widow Calms YOU Down ? (Face Touching & Soft Spoken, Up Close Personal Attention)

Shh I am here to calm you down tonight. If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PATREON (60+ EXCLUSIVE ASMR VIDS & COSPLAY) ? https://www.p

Dhiyanoiseasmr

ASMR Tattoo Tracing on my Body to Give YOU Tingles ✏️? (Skin Sounds, Visual Triggers, Whispered)

I hope you like my new ink ? Enjoy this tingly experience. Thanks for watching! If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PATREON (60+ EXCLUS

Dhiyanoiseasmr

ASMR FOLLOW MY SIMPLE INSTRUCTIONS...again ?? (for Sleep & Tingles)

You must listen and follow all of my instructions, I promise you will sleep. Thanks for watching! If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PAT

Dhiyanoiseasmr

fever dream ASMR

Subs(395) Views(23631)

Last Update (07/2021)

Dhiyanoiseasmr

i did not do drugs before filming this (chaotic and unpredictable ASMR)

wow my hair really is so frizzy wowowowow #asmr #chaotic #unpredictable

Dhiyanoiseasmr

ASMR what it's like working from home (whispering)

let me talk talk talk talk talk and hopefully you'll be relaxed

Dhiyanoiseasmr

ASMR touching pretty glass things (tapping, whispers, lid sounds, smoke)

im a little low energy in the video today, sorry about that. filming has been very difficult for me and i feel like i'm just doing the same things over and over. i hope you enjoy regardles Click here to skip gum chewing 08:50 00:00 intro 02:06 lighting an

Dhiyanoiseasmr

RealMouth ASMR

Subs(1390000) Views(225279209)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR MUKBANG :) Various Convenience Store Food Sausages, Pasta, Sandwiches Eating Show!

#Sausages #Pasta #ASMR #MUKBANG Various Convenience Store Food Sausages, Pasta, Sandwiches Hello~! Nice to meet you! ? Today's menu is Various Convenience Store Food! ? Three sausages in different shapes. Creamy Pasta Pork Cheese Sandwich They als

Dhiyanoiseasmr

ASMR MUKBANG :) Crispy Sweet and Sour Pork Eating Show!

#Pork #Crispy #ASMR #MUKBANG Crispy Sweet and Sour Pork Hello~! Nice to meet you! ? Today's menu is Crispy Sweet and Sour Pork! ? This is one of the most popular delivery foods in Korea! ? It was made by frying the soft pork after coating it wit

Dhiyanoiseasmr

ASMR MUKBANG :) A collection of popular videos in June!

#ASMR #MUKBANG A collection of popular videos in June Hello! Nice to meet you! ? June, the middle of 2021, is already coming to an end :) What happy things have happened to you in the past 6 months? So many things happened this year. Every day, differe

Dhiyanoiseasmr

ASMR Star

Subs(71000) Views(6321681)

Last Update (07/2021)

Dhiyanoiseasmr

BTS (방탄소년단) Butter but in ASMR

?Instagram: theasmrstar ?Custom videos: www.wisio.com/ASMRStar For inquiries: asmrstar4@gmail.com

Dhiyanoiseasmr

Need To Know by Doja Cat but ASMR

For inquiries: asmrstar4@gmail.com ?Instagram: theasmrstar ?Custom videos: www.wisio.com/ASMRStar

Dhiyanoiseasmr

Yonaguni by Bad Bunny but ASMR

?Instagram: theasmrstar ?Custom videos: www.wisio.com/ASMRStar For inquiries: asmrstar4@gmail.com

Dhiyanoiseasmr

Serene Splendor ASMR

Subs(3750) Views(655387)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Bible Reading: Ruth - Soft Spoken

I love how God shows us in the book of Ruth that, regardless of where we come from, we are still valued in His eyes. As a Moabite woman, Ruth probably wasn't the most obvious choice to carry the lineage of King David, yet through her loyalty to Naomi, we g

Dhiyanoiseasmr

ASMR: Pauanui Beach with chatting and prayer

I had a few days away with my family at Pauanui on the Coromandel this week. I hope you enjoy some of the scenery while we chat and pray.

Dhiyanoiseasmr

ASMR Bible Study - The Dying Thief (Soft Spoken)

If ever there was a bad time to ask for something...

Dhiyanoiseasmr

Prim ASMR

Subs(173000) Views(32359373)

Last Update (07/2021)

Dhiyanoiseasmr

Nintendo Switch Animal Crossing Special Edition Unboxing ASMR

Dhiyanoiseasmr

Close Up Personal Attention ASMR Gentle Hand Movements • SK SK SK • Inaudible Whispers in Your Ears

I hope you enjoy this. ♥️ My second channel: https://www.youtube.com/channel/UCeluW_wlg6bPHaTDI2I2aJA What does ASMR stand for? Autonomous Sensory Meridian Response What IS ASMR? A feeling of well-being combined with a tingling sensation in the sc

Dhiyanoiseasmr

Asking you Random Questions • ASMR Typing Sounds • Click Click •

I hope you enjoy this. ♥️ My second channel: https://www.youtube.com/channel/UCeluW_wlg6bPHaTDI2I2aJA What does ASMR stand for? Autonomous Sensory Meridian Response What IS ASMR? A feeling of well-being combined with a tingling sensation in the sc

Dhiyanoiseasmr

LightRoastASMR

Subs(2210) Views(202174)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Digital Art + Commentary

Join me in procreate as I draw a canvas under the theme “Adversity” along with some Bible talk ramblings.

Dhiyanoiseasmr

ASMR - “The Lamb of God” Soft Spoken + digital art

I discuss the Bible what “the Lamb of God” means while a draw a relevant picture on my iPad via procreate.

Dhiyanoiseasmr

ASMR Bible Ramblings: The 7th Day

It has been way too long. Thanks for your patience. A video, rambling about the 7th day of creation and sketching on my iPad as I talk. God bless!

Dhiyanoiseasmr

MH ASMR

Subs(2520) Views(87463)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Camera tapping on my iPhone | LoFi

Dhiyanoiseasmr

ASMR | True Crime: Shanda Sharer

Dhiyanoiseasmr

ASMR | True Crime | The Oakland County Child Killer | Hubba-Bubba Gum chewing (unsolved mystery)

Dhiyanoiseasmr

Creative Calm ASMR

Subs(356000) Views(92106062)

Last Update (07/2021)

Dhiyanoiseasmr

FAST & FURIOUS ASMR ? *super tingly fast triggers to make you tingle*

Welcome you! In this asmr fast and furious special, you'll enjoy a selection of fast trigger sounds to make you tingle! *combined with my super awkward rambles ofc* ➸New quietly entertaining content 3 times a week - every Tuesday, Thursday and Sunday. 1

Dhiyanoiseasmr

ASMR IN BED WITH YOU ? Bedtime Stories For Sleep

Welcome you! In this asmr in bed with you bedtime story reading video you'll enjoy some comforting personal attention, combined with story readings to help you fall asleep. ➸New quietly entertaining content 3 times a week - every Tuesday, Thursday and S

Dhiyanoiseasmr

ASMR Studying You VERY Closely | Personal Attention

Welcome you! In this asmr studying you very closely video, you'll enjoy lots of rather shy personal attention from your cute study buddy (who you may have seen before!). Enjoy lots of writing and sketching sounds! ➸New quietly entertaining content 3 tim

Dhiyanoiseasmr

ASMR COSMONAUT

Subs(10000) Views(1595693)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ICNBUYS Zen garden & Unboxing and Relaxing Playing with Zen Garden (No Talking)

Purchased Zen Garden Products from: https://www.amazon.com/dp/B01II9PHI4 PLEASE, USE THE HEADPHONES! 00:00 - 01:28 - Introduction (Whisper ENG) 01:29 - 18:42 - Unboxing with tapping, scratching, rubbing, rustling and items showing 18:43 - 41:50 - Zen G

Dhiyanoiseasmr

ASMR #2 Russian Language Lesson From Native Speaker & Numbers for the Beginners

PLEASE, USE THE HEADPHONES! The second ASMR Russian Lesson is dedicated to numbers and their endings. So, it is a lesson for the beginners and you can skip this part, if this theme is well-known to you :) -------------------------------------------------

Dhiyanoiseasmr

ASMR Cluedo Tracing & Inaudible Close Up Whispering & Mouth Sounds (Inaudible Whisper)

PLEASE, USE THE HEADPHONES! Tracing became one of my favorites triggers not a long time ago. Also I wanted to try inaudible whispering. I decide to combine these triggers in this video. Let me know what do you think about it :) --------------------------

Dhiyanoiseasmr

Jessica Christine ASMR

Subs(321) Views(10339)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Up Close, Ear To Ear, Relaxing, Inaudible Whispers | Slow Hand Movements | Sleepy Mic Brushing!

Hi guys welcome to my ASMR channel! This video was made to help YOU relax and sleep. In this video I do up close slow, breathe-y, ear to ear whispers! This is the ultimate video for sleep. The first half I do relaxing semi inaudible whispers & second half

Dhiyanoiseasmr

KYLIE JENNER'S FRIEND DOES YOUR MAKEUP | ASMR | Personal Attention | Sassy ASMR | Makeup Application

Hi guys welcome to my ASMR channel! This video was made to help YOU relax and sleep. In this video I do a role-play of being one of Kylie Jenner's best friends. Me and you both live in the hidden hills in Calabasas, CA where Kylie lives. You want me to do

Dhiyanoiseasmr

ASMR URTHBOX UNBOXING VIDEO VEGAN SNACK BOX | Object Tapping, Crinkles, Scratching | Whispering Zzzz

Urthbox (non-affiliate link) just here if you guys wanna try! https://www.urthbox.com *If you are a business/company who would like to contact me about business inquiries...please email me at: jessicachristineasmr@gmail.com ---- Follow me on my social

Dhiyanoiseasmr

ASMRWithOllie

Subs(13200) Views(1658529)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] COVID-19 Test Roleplay | Medical Doctor Coronavirus | Soft Spoken Personal Attention & Gloves

Hello! It's been a fair while since my last upload - the whole audiobook debacle sent me into a bit of a tailspin and I feel like the first part of this video wasn't as "ASMR-esque" as I would have liked but when it gets into the testing part I'm quite hap

Dhiyanoiseasmr

[ASMR] Wrapping Christmas Presents With Your Boyfriend Roleplay

Hello! This was... a long video to edit - I was in two minds about actually uploading it if I'm honest, mostly due to the echo but I felt like the wrapping sounds were super loud too. In the end, I decided I'd leave the decision up to you! If you don't fin

Dhiyanoiseasmr

[ASMR] Ramble With A Tiny $1 Microphone

Hello! Check out the Santa Christmas Subway Run game on IOS (and Google Play soon). There's a link below as well - this video is a bit of nonsense but I hope you enjoy it! The triggers in this video are literally just soft speaking, some whispering and a

Dhiyanoiseasmr

bluezzz ASMR

Subs(4900) Views(544920)

Last Update (07/2021)

Dhiyanoiseasmr

Welcome To The Coven (Witch ASMR, Soft Spoken, Singing)

This video is my part for the collaboration put together by the amazing CalmingEscape ASMR. Please go give her a sub - links to her channel and the collab video will be right under. This is a soft spoken video with hand movements, singing and some bubbling

Dhiyanoiseasmr

ASMR Eye Exam - Light Test, Eye Chart, Follow Finger (Soft Spoken)

Hey guys! Hope you are having a great weekend. I'm sorry I'm not uploading as regularly as I used to but... life. This video includes triggers like light triggers, visual triggers, soft spoken, whispers, eye chart, glass dropper, follow the finger... Hope

Dhiyanoiseasmr

ASMR Unboxing Dolls Kill Shoes - Black Combat Boots

Hey guys! In tonight’s video, I’m gonna unbox my favourite pair of shoes - super chunky Dolls Kill Dark Dominion boots. Its a casual chatty video with some tapping, crinkles and scratching. Soft spoken. Sorry for being awkward, I haven’t filmed for a

Dhiyanoiseasmr

NUNSAEGI ASMR 눈새기

Subs() Views(3141049)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR FRUIT CANDY TANGHULU EATING SOUNDS MUKBANG * Strawberry, Watermelon, Kiwi / Nunsaegi ASMR 눈새기

ASMR 생과일사탕 탕후루의 맛있는 소리를 들려드릴께요 딸기, 수박, 키위, 방울토마토, 파인애플 과즙이 많은 생과일로 탕후루를 만들면 맛과 향이 진해져서 더 맛있고 소리도 좋아요^^ * 자막을 ?

Dhiyanoiseasmr

ASMR MYSTERIOUS MERMAID DESSERTS * 바닷속 인어공주 디저트 * EATING SOUNDS MUKBANG / Nunsaegi ASMR 눈새기

ASMR 인어공주가 살고 있는 바닷속 신비한 세상 이야기를 디저트에 담아봤어요 조개와 진주, 작은 돌 들과 인어공주, 재미있는 바닷속 세상으로 가보시죠~ 바닷속 인어공주 디저트를 표현하기 위

Dhiyanoiseasmr

ASMR KOREAN ICE CREAM EATING SOUNDS MUKBAGN * 맛있고 시원한 아이스크림 먹방 / Nunsaegi ASMR 눈새기

ASMR 여름이면 더욱 생각나는 여러가지 맛있는 아이스크림 먹방을 준비했어요 돼지바, 오레오, 바나나, 메로나, 소다맛 두꺼비, 허쉬 토피넛 앤 초코바, 월드콘 한국의 아이스크림이 얼마나 맛있?

Dhiyanoiseasmr

Al Lullaby ASMR

Subs(30300) Views(22341773)

Last Update (07/2021)

Dhiyanoiseasmr

Two Hair Dryers Sound 21 | ASMR | 1 Hour White Noise to Sleep and Relax

This video involves two old vintage hair dryers. The first one is a Menowatt Ariel 450W, the second one a Menowatt Original Ariel 500W, both with their concentrator nozzle inserted. I do love old vintage chrome hair dryers. They make a soothing sound and

Dhiyanoiseasmr

Hair Dryer Sound 149 | Playing with a Fur | 9 Hours Long Extended Version

At last, the 9-hour long extended version of this video! ? The main character of this video is a brand new Philips DryCare Essential hair dryer. As usual, after about one hour the video fades into a black screen. As always, there are no ads: no adver

Dhiyanoiseasmr

Soothing Hair Dryer Sound 180 | Visual ASMR | 1 Hour Lullaby to Sleep

This video is all about a brand new Aigostar 32000 GPO hair dryer, with its diffuser inserted. I hope you enjoy it! ? Al Lullaby, the hair dryer collector P.S. Follow me on Twitter too: https://twitter.com/AlLullaby

Dhiyanoiseasmr

AWESOME어썸

Subs(3260) Views(527918)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR toy dentist play no talking 장난감 치과놀이 [어썸]

Dhiyanoiseasmr

ASMR toy cooking table omniscient play no talking 장난감 전지적 조리대 시점 [어썸]

Dhiyanoiseasmr

ASMR toy squishy sound play no talking 장난감 스퀴시 소리 [어썸]

Dhiyanoiseasmr

Kaisla ASMR

Subs(4660) Views(315671)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Singing You to Sleep & Triggers (Tapping, Mic Brushing, Kalimba) 30 Minutes ✨ ASMR MUSIC ✨

In this ASMR MUSIC video I'm Singing you to sleep and making music with different Triggers (Tapping, Mic Brushing, "Tk", Soft Spoken, Hand Movements). I'm also playing Kalimba. I'm singing a song that I wrote many years ago! I love Music ASMR and "Sing yo

Dhiyanoiseasmr

ASMR SUOMI | KUISKAILUA ✨ Epätoivon hetkiä ja suuria tunteita ✨ Whispers in Finnish (Lofi)

Tällä ASMR SUOMI -videolla on luvassa pelkkää kuiskailua suomeksi (Lofi), eli en tee muita ääniä. Kerron mun kuulumisia ja puhun mm. epätoivon tunteista (PMS) ja kerron mitä oon tehnyt tällä viikolla, eli arkista höpöttelyä luvassa! Toivottav

Dhiyanoiseasmr

ASMR SUOMI | HÖPÖTTELYÄ & MIKIN SIVELYÄ | Kuiskailua ja kuulumisia✨ Whispering in Finnish & Brushing

Tällä ASMR SUOMI -videolla on luvassa höpöttelyä ja mikin sivelyä! Tällä videolla on pelkästään kuiskailua suomeksi ja mikin sivelyä meikkisiveltimellä. Kerron kuulumisia ja höpöttelen arkisia juttuja, ja kerron myös yhdestä uudesta podcas

Dhiyanoiseasmr

Valeriya ASMR

Subs(866000) Views(224009862)

Last Update (07/2021)

Dhiyanoiseasmr

Dive in my ASMR ? Why is my ASMR so special?

We are all special and that's why we are here. Let's plunge into the world of my ASMR and I will show you new sensations. 00:00 let’s dive in 01:21 why you are here 02:23 what is the purpose of ASMR 03:47 who is ASMR for 05:44 where does ASMR come from 0

Dhiyanoiseasmr

#shorts ONE MINUTE ASMR ⏰?

A little warm-up before Sunday video for you. Fast triggers in 1 minute. I hope you will enjoy. #asmr #shorts

Dhiyanoiseasmr

ASMR You’re too thorny ? Cleaning and trimming your bush ? rose-play ?

Install Raid for Free ✅ Mobile and PC: https://clik.cc/Qe47P and get a special starter pack ? Available only for the next 30 days ? You are so thorny. Let's trim your thorns and leaves! Today I will pamper you: clean your leaves and buds, trim you

Dhiyanoiseasmr

SingStar ASMR

Subs(442) Views(66294)

Last Update (07/2021)

Dhiyanoiseasmr

Eating Corn Cakes and Peanut Butter | Whispering | SingStar ASMR

Crunchy Corn Cake eating ASMR video... Enjoy! SS SUBSCRIBE and Click the BELL to get notified when i have a new video!!

Dhiyanoiseasmr

DOCTOR WHO, SONIC SCREWDRIVER ASMR & WHISPERS and Mic Scratching! Singstar ASMR

SONIC SCREWDRIVER ASMR and whispered chat. Trigger tingles!! Welcome... BIG TINGLES for you!! Maybe to a little soft singing too? SS Twitter @singstarASMR Insta singstar_asmr

Dhiyanoiseasmr

Carpet Scratching | REQUEST VIDEO | NO TALKING | SingStar ASMR

A request ASMR video, Carpet rubbing and Scratching... Enjoy! SS SUBSCRIBE and Click the BELL to get notified when i have a new video!!

Dhiyanoiseasmr

Lottie K ASMR

Subs(7890) Views(160334)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Latex Glove Sounds & Hand Movements

Hi Everyone. I hope this video helps you relax and sleep well tonight :) ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) paypal.me/lottiekasmr Goodnight x #lottiekasmr

Dhiyanoiseasmr

ASMR Fixing you | Random Mechanic Roleplay

Hi Everyone. I hope this video helps you relax and sleep well tonight :) ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) https://www.paypal.com/paypalme/lottiekasmr Goo

Dhiyanoiseasmr

ASMR Photoshoot, doing your hair & make up

Hi Everyone. I hope this video helps you relax and sleep well tonight :) Sorry I'm a bit out of practice ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) https://www.paypa

Dhiyanoiseasmr

GusBR ASMR

Subs(13200) Views(1280802)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR AO VIVO - RELAXE ESTA NOITE com GusBR ASMR

AJUDE O CANAL DE GRAÇA!! Cadastre-se no tiktok com meu link!!! https://vm.tiktok.com/ZMduAbxXj/ Fiquem atentos!!!! Email para contato: gustavoasmr@gmail.com O que é ASMR? ASMR significa Autonomous Sensory Meridian Response. É uma palavra não ci

Dhiyanoiseasmr

LIVE ASMR GUS BR PARA ACALMAR SUA NOITE

Vídeo da Andris - https://youtu.be/CCfdcGiCs68 AJUDE O CANAL DE GRAÇA!! Cadastre-se no tiktok com meu link!!! https://vm.tiktok.com/ZMduAbxXj/ Fiquem atentos!!!! Email para contato: gustavoasmr@gmail.com O que é ASMR? ASMR significa Autonomous

Dhiyanoiseasmr

ASMR Binaural ? Whisper Ear to Ear (AVISO LIVESTREANS)

Cadastre-se no tiktok com meu link!!! https://vm.tiktok.com/ZMduAbxXj/ Aguardem novidades este final de semana!!!! Fiquem atentos!!!! Email para contato: gustavoasmr@gmail.com O que é ASMR? ASMR significa Autonomous Sensory Meridian Response. É um

Dhiyanoiseasmr

ASMR Xperimentalism

Subs() Views(11721)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR MUKBANG Thai Chilli & Honey Garlic Wings (No Talking) EATING SOUNDS 먹방

Welcome to ASMR Xperimentalism! Thank you for becoming part of my little xperiment. ???? , ????????? & tickle that ????? ASMR MUKBANG Thai Chilli & Honey Garlic Wings (No Talking) EATING SOUNDS 먹방

Dhiyanoiseasmr

ASMR 100% Tingle Trigger Words

Welcome to ASMR Xperimentalism! Thank you for becoming part of my little xperiment. ???? , ????????? & tickle that ????? This video includes trigger words that should provide you some tingles from the

Dhiyanoiseasmr

ASMR 100% Non Stop Synthetic Fire Crackling Sound for Sleeping & Relaxation

Welcome to ASMR Xperimentalism! Thank you for becoming part of my little xperiment. ???? , ????????? & tickle that ????? This video includes my attempt to make fire crackling sound that should provide

Dhiyanoiseasmr

Luminin - ASMR Let's Plays

Subs(5600) Views(1328723)

Last Update (07/2021)

Dhiyanoiseasmr

The NAMELESS King... ASMR Edition?! | ASMR Dark Souls 3 | ASMR Gaming & Let's Play

ASMR Dark Souls 3 is part of an ASMR Let's Play & Gaming series designed for relaxation. ► Check out the full playlist, including ASMR Dark Souls 3 : https://www.youtube.com/playlist?list=PLu33DZHAUNamH3wox08pRcFiznVNicQ9I ► Want to see a game like ou

Dhiyanoiseasmr

Diablo ROBBED Me Of MVP?! | ASMR Heroes Of The Storm | ASMR Gaming & Let's Play

ASMR Heroes Of The Storm is part of an ASMR Let's Play & Gaming series designed for relaxation. ► Check out the full playlist, including ASMR Heroes Of The Storm : https://www.youtube.com/playlist?list=PLu33DZHAUNakN_gXTQI7J8Ce4sXgChytO ► Want to see

Dhiyanoiseasmr

Upcoming PORT-A-FORT Update Hype! | ASMR Fortnite Battle Royale | ASMR Gaming & Let's Play

ASMR Fortnite Battle Royale is part of an ASMR Let's Play & Gaming series designed for relaxation. ► Check out the full playlist, including ASMR Fortnite Battle Royale : https://www.youtube.com/playlist?list=PLu33DZHAUNam2sv1J5ihDhByBqxDm8pEh ► Want t

Dhiyanoiseasmr

WithLove L ASMR

Subs(4750) Views(161439)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Gentle Personal Attention ? Up Close Whispers, Hair Brushing, Trigger Words, Touches & Tracing

I have noticed a lot of my requests from my subscribers are personal attention triggers! So I wanted to make a video full of them to help you guys with the most amazing personal attention! I did face touching tracing & poking, Your top fav trigger words, l

Dhiyanoiseasmr

ASMR ⚘ TONS OF TRACING ON YOUR FACE & OBJECTS ☆ Visual Triggers for Sleep

I really love watching other ASMRtists trace on objects and on the camera lens while whispering.. So I wanted to do a video with only tracing triggers! I hope you love tracing ASMR as much as I do friends! I traced on lots of random objects, including your

Dhiyanoiseasmr

Ls Live ASMR ❤ Mixed Triggers For Sleep ?

Hey! I'm so glad you could be here. ??❤ Request some triggers hehe Want to officially become my bestie!? Check out my Patreon! http://Patreon.com/WithLoveL Thank you to my 3 Patrons! I have been working on my Patreon more lately and I have reco

Dhiyanoiseasmr

Articulate Design ASMR

Subs(156000) Views(32104466)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Librarian Roleplay (Rain Sounds, Page Turning, Pouring Tea)

Enjoy tonight's layered rain sound, librarian roleplay! This has been requested quite a few times and I hope you enjoy it and find it, at least a little relaxing. A huge thank you to MVMT for sponsoring tonight's video. Check out their amazing selection w

Dhiyanoiseasmr

ASMR - Realistic, Full Physical Examination Roleplay (Follow The Light, Memory Tests, Reflexes)

So for tonight, we have a realistic, relaxation focused physical examination! I decided to make this a little more organic because of the difficulties the flashlight creates for a proper green screen. So instead, i bought some eye charts, printed some clin

Dhiyanoiseasmr

ASMR - Sleep Inducing Haircut & Styling Roleplay

Welcome along to Articulate Style! Where we try to blend relaxation with traditional, professional cutting techniques and using only the finest products ! I hope you sleep well and -----------------------------------------------------------------------

Dhiyanoiseasmr

SUNFLOWER ASMR

Subs(1870) Views(177820)

Last Update (07/2021)

Dhiyanoiseasmr

GIRLFRIEND PLAYS ANIMAL CROSSING SO YOU CAN FALL ASLEEP ROLEPLAY | ASMR

so i’ve been wanting to do more roleplay but i’m not sure which ones and if i even do them good so let me know if you guys enjoyed it and give me some suggestions down below :)?

Dhiyanoiseasmr

ASSORTMENT TRIGGERS FOR YOUR PLEASURE | ASMR

happy one year to all of us! thank you so much for the love and support and i can’t wait for what the future holds. thank you again for sticking with me :) ?

Dhiyanoiseasmr

MOUTH SOUNDS + GUM CHEWING + RAMBLE | ASMR

and here i am back again :) anyways for real this time i will be back let’s just hope i don’t get locked out of my gmail accounts! goodnight and i hope you all are well rested ?

Dhiyanoiseasmr

Kixshani ASMR

Subs(2100) Views(380168)

Last Update (07/2021)

Dhiyanoiseasmr

I'm opening a new channel: bye bye KIXSHANI

New channel : http://www.youtube.com/hermetickitten Old channel : www.youtube.com/kixshani

Dhiyanoiseasmr

Apro un nuovo canale: ARRIVEDERCI KIXSHANI :')

ANNUNCIO IMPORTANTE! Apro un nuovo canale : Hermetic Kitten http://www.youtube.com/channel/UCR9ehrySGCcxFNg8gCA2rsQ/videos Kixshani resterà sempre aperto,ma tutti i nuovi video li caricherò sul nuovo canale! :) è un cambiamento molto importante e sono

Dhiyanoiseasmr

ASMR Lullaby-Ninna Nanna (multiple languages) with Blue Microphone

Volevo provare qualcosa di nuovo,quindi ho scelto alcune ninne nanne della mia infanzia in Francese,Inglese,Spagnolo ed Italiano,per il vostro rilassamento e farvi addormentare! :3 Hello! I wanted to try something different,so I picked some lullabies from

Dhiyanoiseasmr

Steven ASMR

Subs(57100) Views(7623626)

Last Update (07/2021)

Dhiyanoiseasmr

Papa Is Home DDLG 18+ ASMR

https://www.instagram.com/steven_panda1989/

Dhiyanoiseasmr

Let Daddy Comfort You ASMR DDLG 18+

https://www.instagram.com/steven_panda1989/ Merch Store: https://shop.spreadshirt.com/undead-psycho-panda-army-shop

Dhiyanoiseasmr

Sweet Daddy Aftercare DDLG 18+ ASMR

https://www.instagram.com/steven_panda1989/ Steven ASMR Shop: https://shop.spreadshirt.com/undead-psycho-panda-army-shop/all #PsychoPandaArmy #DDLG #Aftercare

Dhiyanoiseasmr

Torry Sound - ASMR

Subs(2110) Views(271648)

Last Update (07/2021)

Dhiyanoiseasmr

Scratching /?/ asmr

Scratching? asmr Please don't forget to Subscribe ❤️to my channel, Like the video and Leave a Comment ? PayPal: https://www.paypal.me/torrysound ? E-mail for business/customs torrysound@gmail.com

Dhiyanoiseasmr

ASMR ? LICKING LENS

Please don't forget to Subscribe ❤️to my channel, Like the video and Leave a Comment ? PayPal: https://www.paypal.me/torrysound ? E-mail for business/customs torrysound@gmail.com

Dhiyanoiseasmr

ASMR ear eating ?

ASMR ear eating asmr Please don't forget to Subscribe ❤️to my channel, Like the video and Leave a Comment ?DONATE: PayPal: https://www.paypal.me/torrysound ? E-mail for business/customs torrysound@gmail.com

Dhiyanoiseasmr

ASMR Elii

Subs(956) Views(20710)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR invisible trigger tingles #shorts

Dhiyanoiseasmr

ASMR FABRiC SCRATCHiNG & TAPPiNG ????? FAST clothes sounds

#asmr #asmrfabricscratching #fabricscratching #asmrtingles #tingles #asmrsounds #asmrtrigger #trigger ✨✨ GOOD VIBES ONLY ✨✨ ~ Hiiii Whispi, today it's fabric scratching. Enjoy, relax and sit back ?✨✨✨❣️ ~ Muuuuuch l?ve Elii

Dhiyanoiseasmr

ASMR tingly trigger #shorts

Dhiyanoiseasmr

JasonCreation ASMR

Subs(459) Views(23407)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Yu-Gi-Oh! in 2005 | Shuffling & Test Hands

My Yu-Gi-Oh! video's got quite popular, so it was time for another upload! This time we touch a little bit of nostalgia by going back to how Yu-Gi-Oh! was played in 2005. This was known as GOAT format. This was named after the card "Scapegoat". Some might

Dhiyanoiseasmr

[ASMR] 1-Hour HAND SOUNDS ONLY

Hi! This video is a big compilation of 4 hand sounds only video's I made since the beginning of the channel. I know some people like to have a video up while sleeping, so thought this was a great idea for everyone! Enjoy some crispy hand sounds, finger flu

Dhiyanoiseasmr

[ASMR] Pay Attention & Focus | Fast & Aggressive

Focus! Pay Attention to me. Follow my instructions while I guide you to staying aware. Stay in the moment with me, and everytime I see you slip away, I ask you to pay attention again. This one is fast paced, with high energy. Enjoy :) -------------------

Dhiyanoiseasmr

KiKi ASMR

Subs(2410) Views(244145)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] RELAXING FOOT & LEGS MASSAGE With LOTION? #ASMR #KiKiASMR #footasmr

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary CUSTOM VIDEOS' E-MAIL : chiaranaomi97@live.it

Dhiyanoiseasmr

ASMR | Pure, Wet Mouth Sounds ✨ #mouthsounds #マウスサウンド #KiKiASMR

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary E-MAIL: chiaranaomi97@live.it Hey ciao, sono Kiki ^-^ come avrai notato questo video (no talking)

Dhiyanoiseasmr

ASMR | RAGAZZA TIMIDA ? Shy girl roleplay | 内気な少女ロールプレイ #Whispering #ASMR #KiKiASMR

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary E-MAIL: chiaranaomi97@live.it Ecco qui le mie PLAYLIST: Mouth Sounds/Kissing Sound | マウスサ