Dhiyanoiseasmr

Binaural Eats ASMR

Subs(78900) Views(14350201)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR: AMISH BREAKFAST CASSEROLE (EATING SOUNDS) STORYTIME~SOFT SPOKEN

Hi everyone. In this ASMR video I'm eating a delicious Amish Breakfast Casserole that my wife made for me. I also tell a story about my dad and some of the cool things that I have of his. I hope you like it. Sit back, relax and enjoy the video. Sleep well

Dhiyanoiseasmr

ASMR: ALL NEW~RELAXING SOLITAIRE/EATING CHEWY CANDY~SOFT SPOKEN/WHISPER

Hi everyone. Join me in this ASMR video for a few games of Solitaire. Hopefully I can win a game or two. As always I'll be eating a variety of chewy candy while I play the games. I'm having Swedish Fish, Starburst Fruit Chews and Hi-Chew candy. Sit back, r

Dhiyanoiseasmr

ASMR: OIKOS GREEK YOGURT WITH CRUNCHY APPLES AND ALMONDS (EATING SOUNDS) SOFT SPOKEN

Hi everyone. In this ASMR video I'm having a delicious healthy snack for lunch. I'm eating some Oikos Greek Yogurt with crunchy apples and almonds. I hope you like it. Sit back, relax and enjoy the video. Sleep well my friends. Please like, comment and su

Dhiyanoiseasmr

bluezzz ASMR

Subs(4900) Views(544920)

Last Update (07/2021)

Dhiyanoiseasmr

Welcome To The Coven (Witch ASMR, Soft Spoken, Singing)

This video is my part for the collaboration put together by the amazing CalmingEscape ASMR. Please go give her a sub - links to her channel and the collab video will be right under. This is a soft spoken video with hand movements, singing and some bubbling

Dhiyanoiseasmr

ASMR Eye Exam - Light Test, Eye Chart, Follow Finger (Soft Spoken)

Hey guys! Hope you are having a great weekend. I'm sorry I'm not uploading as regularly as I used to but... life. This video includes triggers like light triggers, visual triggers, soft spoken, whispers, eye chart, glass dropper, follow the finger... Hope

Dhiyanoiseasmr

ASMR Unboxing Dolls Kill Shoes - Black Combat Boots

Hey guys! In tonight’s video, I’m gonna unbox my favourite pair of shoes - super chunky Dolls Kill Dark Dominion boots. Its a casual chatty video with some tapping, crinkles and scratching. Soft spoken. Sorry for being awkward, I haven’t filmed for a

Dhiyanoiseasmr

Serene Splendor ASMR

Subs(3750) Views(655387)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Bible Reading: Ruth - Soft Spoken

I love how God shows us in the book of Ruth that, regardless of where we come from, we are still valued in His eyes. As a Moabite woman, Ruth probably wasn't the most obvious choice to carry the lineage of King David, yet through her loyalty to Naomi, we g

Dhiyanoiseasmr

ASMR: Pauanui Beach with chatting and prayer

I had a few days away with my family at Pauanui on the Coromandel this week. I hope you enjoy some of the scenery while we chat and pray.

Dhiyanoiseasmr

ASMR Bible Study - The Dying Thief (Soft Spoken)

If ever there was a bad time to ask for something...

Dhiyanoiseasmr

ASMR Eating

Subs(7430) Views(2634613)

Last Update (07/2021)

Dhiyanoiseasmr

Проверка связи))

Dhiyanoiseasmr

ASMR Eating - Dumplings / Mousse cake / Cheesecake / АСМР Итинг - Манты/ Муссовое пирожное / Чи?

Если кто-то желает задонатить на развитие канала)) 4274 3200 7242 7811 ASMR, ASMR eating, ASMR Eating Swedish candy, ASMR Eating Marshmallows, ASMR Eating Marmalade, Muckbang, ASMR Relax, ASMR Whisper, ASMR Whisper

Dhiyanoiseasmr

ASMR - Посылка из Англии UNBOXING ASMR Eating Candy Chocolat АСМР Итинг Конфеты

Если кто-то желает задонатить на развитие канала)) 4274 3200 7242 7811 ASMR, ASMR eating, ASMR Eating Swedish candy, ASMR Eating Marshmallows, ASMR Eating Marmalade, Muckbang, ASMR Relax, ASMR Whisper, ASMR Whisper

Dhiyanoiseasmr

Haneul ASMR

Subs(2780) Views(207410)

Last Update (07/2021)

Dhiyanoiseasmr

日本語 ASMR // Painting your Face at a Summer Festival // Soft Spoken Roleplay

Hello everyone, Haneul here! Thank you so much for joining me today, I hope this channel can be a source of peace and comfort for you if you need it. ? In today's video, I will be painting your face at a bright, sunny summer festival! This is the Japane

Dhiyanoiseasmr

한국어 ASMR (eng sub) // Painting your Face at a Summer Festival // Soft Spoken Roleplay

Hello everyone, Haneul here! Thank you so much for joining me today, I hope this channel can be a source of peace and comfort for you if you need it. ? In today's video, I'll be doing your face paint and a fun summer festival. What kind of design would

Dhiyanoiseasmr

日本語 ASMR // Listen to My Voice to Fall Asleep // Repetitive Whispers, Mic Tapping

Hello everyone, Haneul here! Thank you so much for joining me today, I hope this channel can be a source of peace and comfort for you if you need it. ? In today's video, I will be gently tapping on the mic while repeating soothing, relaxing phrases. I h

Dhiyanoiseasmr

Love Today ASMR

Subs(52500) Views(16316461)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Facial Treatment (focusing on nose)

Hi friends, In this video I will be giving you a facial (nose) treatment (whispered). I really hope you enjoy it. :) Thank you and remember to LOVE TODAY ASMR Disclaimer: This video is created for relaxation, entertainment and ASMR/tingles/chills ind

Dhiyanoiseasmr

ASMR VACATION (MILLIONAIRE SERIES)

Hi friends, This video is intended to help you imagine being RICH! A millionaire to be exact. Let’s plan your vacation. This video will be soft spoken and it will include typing. I’ll be giving you an overview of your accommodations. I really hope yo

Dhiyanoiseasmr

ASMR Forehead Treatment

Hi friends, In this video I will be giving you a forehead treatment (whispered). I really hope you enjoy it. :) Thank you and remember to LOVE TODAY ASMR Disclaimer: This video is created for relaxation, entertainment and ASMR/tingles/chills inducing

Dhiyanoiseasmr

Strawberry Moon ASMR

Subs(566) Views(22187)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Turning You Into Pop Art! Personal Attention, Soft Spoken

Relax as I turn your face into Pop Art! I’m in the process of setting up a permanent space for filming, so please excuse the dodgy lighting for a few videos while I wait for it to be finished. I like to call it ‘sleepy chaos’ ? As always, thank

Dhiyanoiseasmr

ASMR Tests With A Whiteboard. Drawing, Soft Spoken

Relax as I take you through some simple tests on my whiteboard :) As always, thank you for being here ??

Dhiyanoiseasmr

ASMR Follow My Instructions - With Gloves

Follow my instructions as I try out different gloves on you :) As always, thank you for being here ??

Dhiyanoiseasmr

Charge ASMR

Subs(1570) Views(78988)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | FASTEST eye exam (SOFT SPOKEN)

We check your eyes faster than the eye can see, here at the FASTEST eye exam. Follow me on Twitch: https://www.twitch.tv/jcharge​​​​​​​​​​​ Twitter: https://twitter.com/JamesCharge Support me directly (NOT required or expected. But

Dhiyanoiseasmr

ASMR | How many sounds can a book make??? (SOFT SPOKEN)

I'm really enjoying these "How Many Sounds" videos. I hope you are too. TIMESTAMPS: 0:00 - Preview 0:27 - Intro 1:35 - Book rubbing 2:10 - Bookmark 2:13 - Tapping on cover 3:57 - Tapping on spine 4:47 - Scratching the cover 6:04 - Scratching the spine 6:4

Dhiyanoiseasmr

ASMR | Fast tapping on random objects (NO TALKING)

I haven't done a no talking vid in a while. So I decided why not make another one? TIMESTAMPS: 0:00 - Intro 0:13 - Gum Box 3:14 - TV Remote 5:25 - Small Fabric Case 7:30 - Red Cup (lid on) 8:20 - Red Cup (lid off) Follow me on Twitch: https://www.twitch.

Dhiyanoiseasmr

Meganbeenthinkin ASMR

Subs(8000) Views(365485)

Last Update (07/2021)

Dhiyanoiseasmr

LIVESTREAM

What is up Goofy Goobers! Today we are talking about a million and one topics! You ROCK! ---------------------------------------------------------------- Special thanks to my awesome Patrons! GOOFY GOOBER - JERRY THE HOMIE - TALIA GOOFY GOOBER - JAY GOOF

Dhiyanoiseasmr

ASMR To Be in The Moment | Positive Affirmations

ASMR To Be in The Moment | Positive Affirmations Personal Attention, Eye Covering, Face Touching, and Guided Thinking. Volume up! Heads down! It's bedtime! ---------------------------------------------------------------- Special thanks to my awesome Pa

Dhiyanoiseasmr

I've Been Wanting To Do A Driving Vlog So Here It Is!

MeganBeenDrivin. I've got a lot of driving on my hands while livin in hawaii, so I think driving vlogs will become a thing! Lets get into it ---------------------------------------------------------------- Special thanks to my awesome Patrons! GOOFY GOOBE

Dhiyanoiseasmr

Sweet Nothings ASMR

Subs(378) Views(15583)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Travel Agent Books Your Next Destination ~ Soft Spoken ~ Typing Sounds || Italy Edition ||

Hey guys! I hope everyones had/having a wonderful day! :) For todays video I'm going to be booking your holiday to magnificent Italy :) For the majority of us at the moment we aren't able to travel so I thought it would nice to dream a little. Italy is a c

Dhiyanoiseasmr

[ASMR] My Golden Box of Relaxing Tingly Sounds

Hello Loves! I really hope you enjoy my new video! :) 00:00 Golden Box Intro 02:25 Glass Jar of Styrofoam Balls 07:56 Shells in Mesh Bag 11:29 Angel Hair (or fairy floss ;P) 15:29 Sea Glass 18:33 Bag of Diamonds 22:31 Slime 27:10 Page Flipping 31:16 Silver

Dhiyanoiseasmr

[ASMR] Personal Attention off an Elvish Princess ~ Soft Spoken

Hello loves! I'm a huge fan of LOTR and and I've always wanted to dress up as an elf so here we are :) It's a lil' blurry at the beginning I'm sorry but it does sort it's self out. So sit back, relax and hopefully enjoy :) Lots of Love! x ***If you enjoye

Dhiyanoiseasmr

Kaisla ASMR

Subs(4660) Views(315671)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Singing You to Sleep & Triggers (Tapping, Mic Brushing, Kalimba) 30 Minutes ✨ ASMR MUSIC ✨

In this ASMR MUSIC video I'm Singing you to sleep and making music with different Triggers (Tapping, Mic Brushing, "Tk", Soft Spoken, Hand Movements). I'm also playing Kalimba. I'm singing a song that I wrote many years ago! I love Music ASMR and "Sing yo

Dhiyanoiseasmr

ASMR SUOMI | KUISKAILUA ✨ Epätoivon hetkiä ja suuria tunteita ✨ Whispers in Finnish (Lofi)

Tällä ASMR SUOMI -videolla on luvassa pelkkää kuiskailua suomeksi (Lofi), eli en tee muita ääniä. Kerron mun kuulumisia ja puhun mm. epätoivon tunteista (PMS) ja kerron mitä oon tehnyt tällä viikolla, eli arkista höpöttelyä luvassa! Toivottav

Dhiyanoiseasmr

ASMR SUOMI | HÖPÖTTELYÄ & MIKIN SIVELYÄ | Kuiskailua ja kuulumisia✨ Whispering in Finnish & Brushing

Tällä ASMR SUOMI -videolla on luvassa höpöttelyä ja mikin sivelyä! Tällä videolla on pelkästään kuiskailua suomeksi ja mikin sivelyä meikkisiveltimellä. Kerron kuulumisia ja höpöttelen arkisia juttuja, ja kerron myös yhdestä uudesta podcas

Dhiyanoiseasmr

ocalymaASMR

Subs(7270) Views(1014582)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Soft-Spoken/Whisper Rambling, Brushing (Test Video)

I'm trying to ease my way back into contributing to the ASMR community! Apologies for the unrefined editing (still getting used to a new program). #nervous

Dhiyanoiseasmr

3D ASMR ~ Gentle Tapping and Tracing the Microphone

***HEADPHONES HIGHLY RECOMMENDED*** Hey hey! It's been awhile, I know. I mentioned it on my Facebook, but my uploads will be slowing down while I'm in school. But don't think I've forgotten about you! This is a shorter than normal video. My dog was real

Dhiyanoiseasmr

~ASMR~ Soft-Spoken Organic Chemistry Tutor Role Play

Hola! This is a tutoring role play for you guys. Just FYI, I didn't fact check anything I said in this video, I just did it all from memory. So just to be safe, don't use this as an educational resource. It's only meant for relaxation. There is a small s

Dhiyanoiseasmr

Afox ASMR

Subs(12200) Views(1369352)

Last Update (07/2021)

Dhiyanoiseasmr

[日本語 ASMR] Whispering Japanese Trigger Words To Help You Sleep | 言葉繰り返し

Hi! this is my first ever Japanese video and I'm very nervous about sharing my speaking Japanese with you guys.. I know I made a few mistakes in pronouncing some words but I will get better! Triggers: 1 カタ 2 友達 3 ニコ 4 ステキ 5 ドキ?

Dhiyanoiseasmr

[ASMR] Little Q&A Part 2! | Soft Spoken

Thanks for everyone's patience in part 2 ^.^ I have been a little busy so took me a while to find time to edit this part. I will be recording some new roleplays REAL soon which I'm happy about! sleep well xoxox

Dhiyanoiseasmr

[ASMR] Little Q&A! Part 1 | Soft Spoken

I finally got round to doing a q&a which turned out to be rather long so I've split it into two videos. I hope you enjoy and maybe get to know me a little better xox

Dhiyanoiseasmr

Wokies ASMR

Subs(58000) Views(9233905)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Ear Cupping | Cricket Sounds | Ambient Noise | 3DIO

The crickets outside sounded so nice! I hope this helped you fall into a very relaxed state. :) Part 2 of Ear Licking free on OF! ?Like and Subscribe! ?Onlyfans: https://onlyfans.com/wokiesasmr ?Links: https://linktr.ee/WokiesASMR ?Business I

Dhiyanoiseasmr

ASMR Girlfriend Comforts Your Headache | Soft Spoken

It was lightly raining outside. I hope this video helps soothe your head. :) ?Like and Subscribe! ?Onlyfans: https://onlyfans.com/wokiesasmr ?Links: https://linktr.ee/WokiesASMR ?Business Inquiries/Custom Video Requests: wokiesasmr@gmail.com

Dhiyanoiseasmr

ASMR Fabric Scratching | No Talking

I hope these fabric sounds help you relax and possibly fall asleep! :) ?Like and Subscribe! ?Onlyfans: https://onlyfans.com/wokiesasmr ?Links: https://linktr.ee/WokiesASMR ?Business Inquiries/Custom Video Requests: wokiesasmr@gmail.com ------

Dhiyanoiseasmr

Velvet Whisper

Subs(11400) Views(1131231)

Last Update (07/2021)

Dhiyanoiseasmr

❄ Snow White ❄ ASMR Whispered Fairy Tale Reading

❁ Email: velvetwhisperasmr@gmail.com ❁ Patreon: https://www.patreon.com/user?u=961374 ❁ Paypal: kantolover@gmail.com ❁ Instagram: https://www.instagram.com/_vvvictoria/ (be warned this is my "personal" instagram, so it's just cat pics, concert pi

Dhiyanoiseasmr

ASMR ?Mic Brushing & Scratching (No Talking)

❁ Email: velvetwhisperasmr@gmail.com ❁ Patreon: https://www.patreon.com/user?u=961374 ❁ Paypal: kantolover@gmail.com ❁ Instagram: https://www.instagram.com/_vvvictoria/

Dhiyanoiseasmr

✺ ASMR Fairy Tales ✺ Whispered Rapunzel Reading

tfw when you forget to take a thumbnail picture ❁ Email: velvetwhisperasmr@gmail.com ❁ Patreon: https://www.patreon.com/user?u=961374 ❁ Paypal: kantolover@gmail.com ❁ Instagram: https://www.instagram.com/_vvvictoria/ (be warned this is my "pers

Dhiyanoiseasmr

Yoloma ASMR

Subs(814) Views(36288)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR The Sculptor (Sculpting Your Face ASMR Roleplay)

#asmr #personalattention #asmrroleplay This is the long version of The Sculptor roleplay from the Mega Collaboration organized and hosted by ASMR Alysaa. Watch the full collaboration here to discover 50+ asmrtists : https://youtu.be/sod3fo_Rxz0 and visi

Dhiyanoiseasmr

ASMR Pop the Popsicle ! Satisfying ASMR Fidget Toy #shorts

#asmr #shorts #short #asmrshort #asmrshorts #1minuteasmr #youtubeshorts #asmrtoy #satisfyingasmr A satisfying ASMR toy ! Pop the popsicle ! Sensory popping toy ! Go pop ! Pop it ! Fidget toy ! No talking and lo-fi ! Follow me on Twitter : @ASMRYoloma Wan

Dhiyanoiseasmr

ASMR Love Apothecary (Medieval Fantasy Roleplay from Spring Elven Festival @ Whisperwind ASMR)

#asmr #roleplay #medievalfantasy #elf #renaissancefair #springfestival #softspoken This is the short version of my part in the Elven Spring Festival ASMR collaboration organized by Whisperwind ASMR. I am the elf tenant of the Love apothecary and I’ll pr

Dhiyanoiseasmr

Gentle Whispering ASMR

Subs(2090000) Views(900308597)

Last Update (07/2021)

Dhiyanoiseasmr

Color Analysis ? ASMR ? Soft Spokenish

Hello friends :) today we'll be taking a closer look at what colors suit my dear husband Darryl best. I hope you enjoy this different type of a video from this channel ♥ Color analysis is a tool designed to help us figure out the colors that are synergy

Dhiyanoiseasmr

Things that Spark Joy ○ ASMR ○ Soft Spoken ○ Chit Chat

Hello :) How have you been? What's new in your world? I've been a bit more exhausted and unsettled lately (said every stay at home parent, lol) BUT also very grateful for my life and today we'll do a chit chat, deal? :D 00:00 why no cool videos, Maria? 02

Dhiyanoiseasmr

Fancy Fabrics ○ ASMR

Welcome to my Fabric Shop, let me show you some of our most amazing materials ♥ 00:00 Preview 3 min long :) 03:18 Welcome 04:02 White flower tulle 10:51 Large layered sequins 16:28 Lint rolling 18:44 Blue velvet with golden applique 26:07 Orange iridesc

Dhiyanoiseasmr

Snowy ASMR

Subs(24100) Views(2358657)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Lets Nap Together ~ Personal Attention ?

Hope you enjoy!! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please note this is 18+ only) ?Patreon - https://www.patreon.com/snowylowther ?Twitter - @xsnowy ?Tiktok - @snowysioux ?Tips - https://www.paypal.com/

Dhiyanoiseasmr

DEEP Ear Picking ASMR - Ear Cleaning Roleplay

This was highly requested! A Ear Cleaning of JUST the Picking tool! Its my favourite sound too and I loooove this trigger in ASMR :) Hope you enjoy!! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please note this is 18+ only)

Dhiyanoiseasmr

Classic Eye Examination ASMR Roleplay

A classic eye examination with glove sounds, follow the light, snellen reading chart, field of vision test, eye drops and person attention with soft spoken/whispering...Enjoy! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please

Dhiyanoiseasmr

DeesSofterSide

Subs(4940) Views(776404)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Whisper Show and Tell- My Shot Glass Collection

I have collected shot glasses for a few years now and so I wanted to feature some in a whisper for you to enjoy. I hope you like it, Sleep Sweet Everyone!

Dhiyanoiseasmr

Whisper Catching Up, I've Missed You Guys!

Thank you for all your patience with me over the years! I've finally invested a bit of money into recording with more than just my iPhone. This will help me to stay more consistent. I hope you enjoy catching up with me a bit. Please comment any requests, h

Dhiyanoiseasmr

ASMR Whisper Sign Language Fingerspelling Lesson

Hi strangers! lol. I am trying to get back into this and thought it would be fun to teach you all how to fingerspell. I hope you enjoy this video, sorry if the editing is weird. I also referenced TheLyricalWhispers. Check him out. Hes awesome. Enjoy! Sleep

Dhiyanoiseasmr

Camilla ASMR

Subs(861) Views(95788)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Crushing Trample with Heeled Sandals Banana peels Relaxation Sounds

Scusate per le mie assenze ma sono settimane difficili per me e lo saranno sempre di più ma farò il possibile per portare qualche video per voi:) Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi vid

Dhiyanoiseasmr

ASMR My Cat Eating a Meat Stick and Soft Spoken ITA ASMR with My Cat Mia

Oggi video un pò diverso dal solito sarà breve ma vi mostro come do da mangiare uno snack al mio gatto Mia. Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi video :) Per richieste video Custom con d

Dhiyanoiseasmr

ASMR Relaxing Neck & Shoulder Massage Personal Attention Relaxing Massage with Oil

Spero di potervi rilassare con questo delicato massaggio al corpo:) Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi video :) Per richieste video Custom con donazione contattatemi via Email: camilla.a

Dhiyanoiseasmr

ASMRtherapy

Subs(3580) Views(752082)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Reporting a Crime to the Police ● Soft Spoken Roleplay

ASMR Roleplay where you are at the local police station reporting that your apartment has been burglarized. I (a police officer working there) will assess the situation and make a report to help you retrieve your items. Everything is soft-spoken and made s

Dhiyanoiseasmr

[ASMR] Dream Job Interview ● Soft Spoken Roleplay

I got an offer you can't refuse... but for this, you will need to take part in this job interview. It's not a usual one by any means.. but again the job itself is quite unusual as well. Hope you enjoy this little ASMR roleplay :) ► Please subscribe if y

Dhiyanoiseasmr

ASMR Robot Check Up & Repair - Roleplay - Relaxing Whisper and Triggers

Anual space robot check-up and repairs roleplay. Whispering and using various different trigers. Whispering roleplay made for relaxation and falling asleep faster. ► Please subscribe if you want some more ► ASMR Therapy Album Vol.1 on Bandcamp (fr

Dhiyanoiseasmr

asmrvilla

Subs(97100) Views(37919245)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR * Up Close Arm & Back Scratching * Pampering my Friend :) * No Talking * ASMRVilla

Hi Everyone! In this video I will be whispering and helping my friend fall asleep as I scratch her back, arms and head :) No Talking Version: https://www.youtube.com/watch?v=mdGmEpu2CEs Instagram: https://www.instagram.com/asmrvillafam/ My ASMR Merch

Dhiyanoiseasmr

ASMR * Tapping through my Gym/Dance Studio * Fast Tapping & Scratching * Soft Spoken * ASMRVilla

Hey Everyone!!! I will be Tapping & Scratching through my Dance Studio and side rooms with Gym Equipment while Softly Speaking with you in this video :) Thank you so much for watching!! No Talking Version: https://www.youtube.com/watch?v=H-I33J3SbNE ?

Dhiyanoiseasmr

ASMR #Shorts * Puffy and Scratchy "Boxes?" * ASMRVilla

Hi Everyone! I wanted to try putting up a Youtube Short for you. Once in a while I film little ASMR clips when I am out and about for you so this will be a perfect place to put them. A quick little tingle in the middle of your day hehe ;) PS Not all con

Dhiyanoiseasmr

Dr Bobby ASMR

Subs(3070) Views(63582)

Last Update (07/2021)

Dhiyanoiseasmr

Dr Bobby ASMR: Beard Sounds.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find these beard sounds relaxing. * disclaimer - I thoroughly washed my hands and face prior to, and immediately following, this video, in addition to using alcohol gel! Very

Dhiyanoiseasmr

Dr Bobby ASMR: Multilayered Sounds Compilation.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find this multilayered sounds compilation relaxing. In this video you get four Bobby's for the price of one ... I'm hoping that's a good thing ... ;) This compilation was made

Dhiyanoiseasmr

Dr Bobby ASMR: Negative Energy Plucking.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find this negative energy plucking relaxing. I think we all deserve to connect with a sense of peace during these difficult times! :) Ps. You're all amazing. Stay safe. x *-*

Dhiyanoiseasmr

Violet Day

Subs(1950) Views(231254)

Last Update (07/2021)

Dhiyanoiseasmr

[ ASMR n°70 ] Whispered SPA Facial Cleanse Roleplay (W/ Relaxing Music)

LONGER VIDEOS ARE BACK! Hi! Welcome back. In this video, you'll be relaxed and pampered by Amelia. She's the best of the best at the salon, and you wanted to book a much longer appointment with her to feel relaxed. Luckily, she can do just that for you!

Dhiyanoiseasmr

[ ASMR n°69 ] : ~Cozy~ Makeover By Your Older Sister. *Part 1* (Short ASMR)

Today, you'll be visted by your older sister Violet- who you've come to for a quick, and simple makeup look. :D She's (almost always) late for work, so she can spare a few extra minutes to help you get that look you were going for! Enjoy. x (OPEN ME!) ~~~~

Dhiyanoiseasmr

[ ASMR n°68 ] : Casual Whispered Tapping & Rambling (Quick Tingles)

Whoa, she's back again? Indeed I am. :D After two long months, this weirdo is back in action for more *frequent* uploads. I apologize for the delay! Know it's been a bit. Anyway- today would've been a typical 19-20 minute video, but my camera decided to c

Dhiyanoiseasmr

Mango ASMR

Subs(135) Views(11440)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Pop It Sounds ? | Soft Spoken

Hello everyone!! It is Mango ASMR! Welcome to my channel :) In this video, l filmed a video with push pop. I hope you that you have a great day and thank you for watching my video :) - Donation https://toon.at/donate/637290160258925718 (Thank you for you

Dhiyanoiseasmr

[ASMR] Keyboard Typing Sound ⌨ | Typing , Clicking , No Talking

Hello everyone!!! It's Mango ASMR. It's very very long time no see. I'm so so sorry about that and thank you for waiting my videos ? Actually l had very important exams.. So, l couldn't upload new videos. I'm so sorry about that? But finally l finish

Dhiyanoiseasmr

[ASMR] Doing My Skincare ?? | My Skincare Routine | Soft Spoken

Hello everyone!! It is Mango ASMR :) Today l will do my skincare. So, l hope you have a peaceful time through this video! Thank you always. - Donation https://toon.at/donate/637290160258925718 (Thank you for your support?) - Song : Arms of Heaven - A

Dhiyanoiseasmr

asmrlovely

Subs(3190) Views(260912)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Gym Membership Consultation & Sign Up ? // Measuring You Roleplay

Hello Lovelies! I hope you enjoy ASMR | Gym Membership Consultation & Sign Up ? // Measuring You Roleplay Welcome to the Lovely Gym! I think I know just the right thing for you and your fitness goals. Join me in your gym consultation and sign up to rec

Dhiyanoiseasmr

ASMR | Men's Shave Barber Shop Roleplay ? | Beard Shave, Trim, & Style

Hello Lovelies! I hope you enjoy ASMR | Men's Shave Barber Shop Roleplay ? | Beard Shave, Trim, & Style Welcome to the Men's Shave Barber Shop! Today I will be helping you with your beard by providing you with an all inclusive beard shave, trim, and st

Dhiyanoiseasmr

ASMR | Night Nurse Takes Care of You In Bed ♥ // Nurse Checkup Medical Routine

Hello Lovelies! I hope you enjoy ASMR | Night Nurse Takes Care of You In Bed ♥ // Nurse Checkup Medical Routine Shhhh...it's 11 PM and your night nurse is here to take care of you [in bed]. I hope you are enjoying your hospital visit so far. Sorry to wa

Dhiyanoiseasmr

Rayy SMR

Subs(18800) Views(4912588)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Weird Fruit and a Binaural Walk in a Rainforest

Hello! This would have been uploaded yesterday, but I need to buy better internet. The upload speed couldn't handle all this fruity goodness. Hope no one else in these apartments needed to use the internet! - - - - - Hi, my name is Sunny and I make this

Dhiyanoiseasmr

ASMR - New Microphone Test (Audio Only)

Hello! This was made pretty last minute in order to have something. It has been a crazy week and I'm really not feeling well today, but at least I could accomplish something! : ) I got a new microphone and I wanted to test out its quality for speech. It a

Dhiyanoiseasmr

ASMR - Moody Artist Works on You (Scratching, Scraping, Brushing, Quiet Whispers)

This video was the first major wake-up call that the space I am in (and/or the way the space is being utilized) is utterly inefficient. There are reasons, some of which are not easy to get around at the moment, but everything is about to shift and then mor

Dhiyanoiseasmr

Adrian ASMR

Subs(2380) Views(202275)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Full Body Massage 2!! (Soft Spoken, Personal Attention)

Welcome back everyone!!! This is the highly requested Full Body Massage Part 2! I really hope you all enjoy :) Thank you all for your incredible support! ❤️❤️

Dhiyanoiseasmr

ASMR - My Favorite Albums of 2020! (Whispered)

Welcome back everyone! I hope you all had a fantastic Christmas and New Years! The long awaited Albums video is here :) I hope you all enjoy! Don't forget to relax ??

Dhiyanoiseasmr

ASMR League of Legends Volibear Gameplay! ? (Keyboard, Mouse Sounds)

Welcome back everyone!! I hope your all doing fantastic :) Doing another League video today! The next will be a roleplay I promise :) Hope you all enjoy!! Don't forget to relax ??

Dhiyanoiseasmr

Kixshani ASMR

Subs(2100) Views(380168)

Last Update (07/2021)

Dhiyanoiseasmr

I'm opening a new channel: bye bye KIXSHANI

New channel : http://www.youtube.com/hermetickitten Old channel : www.youtube.com/kixshani

Dhiyanoiseasmr

Apro un nuovo canale: ARRIVEDERCI KIXSHANI :')

ANNUNCIO IMPORTANTE! Apro un nuovo canale : Hermetic Kitten http://www.youtube.com/channel/UCR9ehrySGCcxFNg8gCA2rsQ/videos Kixshani resterà sempre aperto,ma tutti i nuovi video li caricherò sul nuovo canale! :) è un cambiamento molto importante e sono

Dhiyanoiseasmr

ASMR Lullaby-Ninna Nanna (multiple languages) with Blue Microphone

Volevo provare qualcosa di nuovo,quindi ho scelto alcune ninne nanne della mia infanzia in Francese,Inglese,Spagnolo ed Italiano,per il vostro rilassamento e farvi addormentare! :3 Hello! I wanted to try something different,so I picked some lullabies from

Dhiyanoiseasmr

ASMattR ASMR

Subs(171000) Views(36389138)

Last Update (07/2021)

Dhiyanoiseasmr

A Livestream for ASMR Previously Run by ASMattR of An Airport for Aliens Currently Run by Dogs

In this ASMR livestream, I softly speak and whisper while playing An Airport for Aliens Currently Run by Dogs. Get ready to watch me pet some stock photos of dogs!!! Twitter - https://twitter.com/ASMattR Facebook - https://facebook.com/ASMattRpublic Insta

Dhiyanoiseasmr

ASMR | SCP-3943: "Taco Man" - A Binaural SCP Reading

Hey everyone! In this binaural ASMR video, I softly speak and whisper into your ears about SCP-3943, a taco vendor who somehow became stuck halfway into the side of an office building along with his taco cart. I hope you'll enjoy it! This video is based o

Dhiyanoiseasmr

[ASMR] Let's Build a Theme Park! RollerCoaster Tycoon 2 Soft-Spoken Gameplay

Hey everyone! In this ASMR video, I build a theme park in the classic PC game RollerCoaster Tycoon 2 while giving soft-spoken commentary. I hope you'll enjoy it! Interested in supporting my channel? Feel free to check out my Patreon page!: https://patreon

Dhiyanoiseasmr

Whispers of the Wolf ASMR

Subs(33700) Views(1951594)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR REIKI plucking & scooping anxious thoughts | hand movements, negative energy removal | healing

ASMR REIKI plucking & scooping your anxiety | hand movements, negative energy removal | energy healing and chakra balancing 00:00 intro 01:41 intention setting with candle 02:46 sage smoke cleanse 07:51 reiki symbols 09:49 cleansing sweeps 10:55 scooping

Dhiyanoiseasmr

ASMR REIKI manifest love while you sleep ?chakra balancing, binaural beats, hand movements, whisper

ASMR REIKI attract and manifest love while you sleep ? heart chakra healing, binaural beats 7.83 Hz, guided visualisation, hand movements, energy healing & activation, whispered chakra balancing, finger flutters 00:00 intro 03:16 incense smoke cleanse

Dhiyanoiseasmr

ASMR REIKI drawing & tracing reiki symbols on chakras for sleep | hand movements, balancing chakras

ASMR REIKI drawing & tracing reiki symbols on your chakras for sleep | hand movements, chakra balancing & healing energy 00:00 intro 01:11 introducing the reiki symbols 02:16 cho ku rei 04:11 sei he ki 06:39 hon sha ze sho nen 09:31 reiki symbol sandwich

Dhiyanoiseasmr

iL Asmr

Subs(137) Views(4923)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR HAIRCUT SCISSORS✂️ Personal Barber to Help You SLEEP | FASTEST | ROLEPLAY | RELAX

This#ASMR video involves Brushing Hair, Spraying Bottles sounds, Soft Spoken, Fast and aggressive Scissors Sounds, Fastest Haircut | Personal attention barber to help you SLEEP better. IF thiS ASMR video gives you *Tingles tingles*?entertainment. Let

Dhiyanoiseasmr

Unusual Sounds ASMR⚠️ SLEEP RELAXATION HAIRCUT✂️TINGLES TAPPING iL ASMR?

This #ASMR video has 3Type of Scissors Sounds, Unusual Sound(tape?), Tingles to help you SLEEP better. Please put on your headphone, and enjoy the best audio effect. (?????)? IF thiS ASMR video gives you *Tingles tingles*?en

Dhiyanoiseasmr

ASMR✂️FASTEST Personal Barber+HAIRCUT in One Minute = Scissors Relaxation iL ASMR

This #ASMR video is the Fastest ASMR ever roleplay barber giving you haircut in one minute. It has Scissors, Spraying bottles, Brushing Hair Sounds for Relaxation. Please put on your headphone, and enjoy the best audio effect. (?????)?

Dhiyanoiseasmr

LifeWordASMR

Subs(6040) Views(493672)

Last Update (07/2021)

Dhiyanoiseasmr

How to respond when you’re caught off guard | Christian Lifestyle | Relaxing Devotion

Have you ever been caught off guard in an uncomfortable situation and weren't sure how to immediately respond? Here is a blanket response to the fiery darts the enemy sends your way to knock you off track in your everyday Christian life. Rela

Dhiyanoiseasmr

Channel update - See you soon!

Quick update - not a drastic change, just some focus on bible study, deep discussion, & relaxing Christian talk. Love & miss you all! Christian ASMR

Dhiyanoiseasmr

CHILL OUT Together & Sleepy Bible Meditation ? Rainy Day Christian ASMR ? Whispers, Thunder, & Taps

Let's chill out together on this rainy spring afternoon and meditate on some scripture passages. 100% authentic full thunderstorm sequence! Whispers, leather tapping, thunder and rain. Perfect to relax or fall asleep while enjoying the company of a Christi

Dhiyanoiseasmr

LightRoastASMR

Subs(2210) Views(202174)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Digital Art + Commentary

Join me in procreate as I draw a canvas under the theme “Adversity” along with some Bible talk ramblings.

Dhiyanoiseasmr

ASMR - “The Lamb of God” Soft Spoken + digital art

I discuss the Bible what “the Lamb of God” means while a draw a relevant picture on my iPad via procreate.

Dhiyanoiseasmr

ASMR Bible Ramblings: The 7th Day

It has been way too long. Thanks for your patience. A video, rambling about the 7th day of creation and sketching on my iPad as I talk. God bless!

Dhiyanoiseasmr

Seafoam Kitten's ASMR

Subs(216000) Views(60304166)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - LITTLE RABBIT ~ Meeting a Weird Rabbit Person at Your Hotel ~

You're tired. You're just trying to get back to your hotel room when you're stopped in the hallway by a rather odd person. They are dressed up like a rabbit and call themselves Banana. Chuckling to themselves and speaking in breathy whispers, they seem to

Dhiyanoiseasmr

ASMR - FLUFFY SCALP MASSAGE ~ Brushing You to Sleep | May Patron Appreciation!

Thank you to my $5+ patrons of May, I appreciate you! Sorry this video is like two weeks late but hey at least I uploaded something this time :'DD anyway I hope you enjoy the fluffy ear massage! TIMESTAMPS: 0:59 - Reading your names 6:04 - Fluffy massage!

Dhiyanoiseasmr

ASMR - SAD BOI HOURS ~ Comforting You in the Night | 101 Reasons to Stay Alive ~

Your friend is here to comfort you during sadboi hours!! They give you some tea, silly gifts that make nice tapping sounds, and affirmations while reading a list of reasons to stay alive. I did not write this list!! I initially found this list from a you

Dhiyanoiseasmr

Bearded Audio ASMR

Subs(768) Views(14014)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Tapping On A Wood Box | #Shorts

Here's a nice lil' tapping video for you. Have a great weekend! If you love my work and would like to help me save up for better video gear, join my merry Band of Beards on Patreon! One tier, super cheap, fun for everyone: https://www.patreon.com/beardeda

Dhiyanoiseasmr

ASMR | Measuring Your Entire Body // Personal Attention, Writing Sounds, Soft Spoken Male Voice

It's an exciting day! You're finally being measured for your suit. We'll get your measurements from head to toe, because your entire body will be covered. Gotta keep your identity a secret, right? If you love my work and would like to help me save up for

Dhiyanoiseasmr

ASMR | You are an android with an echo problem // Fixing You, Android Repair, Echo, Gentle Tool Work

Looks like you've got a bit of an echo problem? Your audio phase bolts might need some tweaking, so I'm gonna open up your head's side panels and give 'em a twist. After that you'll be converting audio without that echo, good as new. I love working on old

Dhiyanoiseasmr

fever dream ASMR

Subs(395) Views(23631)

Last Update (07/2021)

Dhiyanoiseasmr

i did not do drugs before filming this (chaotic and unpredictable ASMR)

wow my hair really is so frizzy wowowowow #asmr #chaotic #unpredictable

Dhiyanoiseasmr

ASMR what it's like working from home (whispering)

let me talk talk talk talk talk and hopefully you'll be relaxed

Dhiyanoiseasmr

ASMR touching pretty glass things (tapping, whispers, lid sounds, smoke)

im a little low energy in the video today, sorry about that. filming has been very difficult for me and i feel like i'm just doing the same things over and over. i hope you enjoy regardles Click here to skip gum chewing 08:50 00:00 intro 02:06 lighting an

Dhiyanoiseasmr

Austrian ASMR

Subs(131000) Views(19139950)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Ich flüstere DICH in den Schlaf ❤? | Deutsch/German

Hi guys, und schön, dass ihr wieder für eine Potion Schlaf da seid. Dieses mal ein Video auf Deutsch! Ich hoffe euch gefällts und ihr könnt euch schön entspannen und einschlafen. Passt auf euch auf und bleibt gesund (: ?SOCIAL MEDIA Instagram: au

Dhiyanoiseasmr

ASMR Soft spoken Positive Affirmation ? | Everything is going to be fine

Hi guys, and welcome back to another video. ?SOCIAL MEDIA Instagram: austrianasmrgurl Twitch: AustrianASMR Discord: https://discord.gg/xX32dxnVeE Twitter: Austrianasmrgurl TikTok: austrianasmrgurl Tellonym: tellonym.me/ASMRGurl ?IF YOU WANT TO SUP

Dhiyanoiseasmr

ASMR Trigger Words Whispered ❤

Hi guys, and welcome back to another video! I'm really sorry for not being active for the last couple of weeks, I hope you still enjoy the video. Stay safe and healthy (: ?SOCIAL MEDIA Instagram: austrianasmrgurl Twitch: AustrianASMR Discord: https://

Dhiyanoiseasmr

Reiki Kisses ASMR

Subs(420) Views(32287)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR #shorts Pick a Fairy Card ??‍♀️

Dhiyanoiseasmr

ASMR ? Match Lighting ? Whispers ?

Hi Lovies ? Here is a requested match lighting video ?? Just to warn you * there are lots of background sounds * ? Wishing for your dreams to be lit up like a flame ;) ? & wrapped around you with warmth and love ? Love and huggles to

Dhiyanoiseasmr

ASMR✨ Follow the chain ?⛓| Soft Spoken | Writing Sounds ?

Hi Sweetest Souls ? I don’t really know what I’m doing in this little video ??‍♀️⛓? but thanks for helping me out ? & hope you find it soothing :p?? Love you always x o x ? Email me at ➡️ ? reikikisses@gmail.

Dhiyanoiseasmr

Psk. ASMR HYPNOSİS

Subs(515) Views(25494)

Last Update (07/2021)

Dhiyanoiseasmr

#ASMR Rahatlatıcı sürpriz hediye?! Stres alan Sihirli kelimelerle seni uyutuyorum#TürkçeAsmr#uyku

??‍Videomu izleyen Güzel insan; Asmr keyfine hoşgeldin, Senin için aldığım rahatlatıcı hediyeyi açıyoruz sen beni izlerken kutunun icindekini tahmin etmeyi unutma ve hediye açıldıktan sonra Rahatlatıcı uyku öncesi seansini kaçır

Dhiyanoiseasmr

ASMR UYKU GETIREN KÜTÜPHANECi ROLEPLAY #TürkçeAsmr#Fısıltı#Rahatuyku

??‍Videomu izleyen Güzel insan; Asmr keyfine hoşgeldin, Abone olduğun için teşekkürler,✨ Huzurlu seyirler ? Kanalımda ki diğer içerikler için; İletişim: vikiasmr2020@gmail.com ✨Kişilik testi-1 videom; https://youtu.be/vaErCk

Dhiyanoiseasmr

ASMR UYKU ROBOTU seni Hipnozla uyutuyor #Roleplay #TürkçeAsmr#Hipnoz

??‍Videomu izleyen Güzel insan; Asmr keyfine hoşgeldin, ASMR Robot Roleplay videom da spiral background eşliğinde etkileyici bir HİPNOZ deneyimi yaşayacaksınız. Abone olduğun için teşekkürler,✨ Huzurlu seyirler ? Kanalımda ki

Dhiyanoiseasmr

Prim ASMR

Subs(173000) Views(32359373)

Last Update (07/2021)

Dhiyanoiseasmr

Nintendo Switch Animal Crossing Special Edition Unboxing ASMR

Dhiyanoiseasmr

Close Up Personal Attention ASMR Gentle Hand Movements • SK SK SK • Inaudible Whispers in Your Ears

I hope you enjoy this. ♥️ My second channel: https://www.youtube.com/channel/UCeluW_wlg6bPHaTDI2I2aJA What does ASMR stand for? Autonomous Sensory Meridian Response What IS ASMR? A feeling of well-being combined with a tingling sensation in the sc

Dhiyanoiseasmr

Asking you Random Questions • ASMR Typing Sounds • Click Click •

I hope you enjoy this. ♥️ My second channel: https://www.youtube.com/channel/UCeluW_wlg6bPHaTDI2I2aJA What does ASMR stand for? Autonomous Sensory Meridian Response What IS ASMR? A feeling of well-being combined with a tingling sensation in the sc

Dhiyanoiseasmr

River ASMR

Subs(58100) Views(7241891)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ⛵Captain Takes Care Of You

? Go to https://surfshark.deals/RIVER enter promo code RIVER for 83% off and get 3 months totally free. Trigger Menu 00:00 Surfshark tingles prelude 01:07 show begins 02:00 serves liquid refreshment 03:55 magnifying glass 04:30 tending to graze 05:05 w

Dhiyanoiseasmr

ASMR Skincare Beautician Treatment [Cleanse, Face Scrub, Cream, Massage]

Use the code RIVER to get 25% off - see pinned comment! 00:00 Beauty Consultant Overview 03:30 Inspection 04:30 Creamy Charcoal Cleanser with Chamomile Extract 06:00 Sample Slice 06:40 Apply Cleanser 11:35 Facial Scrub with Eucalyptus 14:15 Sample Slice 1

Dhiyanoiseasmr

Best Budget Selfie Light 2021? Enhance your Beauty!? TONOR TRL-20 12'' Ring Light with Tripod Stand

UK ?? https://amzn.to/2QPQ1S5 (10% discount code: RiverTonor) US ?? https://amzn.to/37AQygl (20% discount code : Ringlight2) ? Tonor Website: https://www.tonormic.com/collections/ring-light For transparency, please note that I've never us

Dhiyanoiseasmr

ASMR COSMONAUT

Subs(10000) Views(1595693)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ICNBUYS Zen garden & Unboxing and Relaxing Playing with Zen Garden (No Talking)

Purchased Zen Garden Products from: https://www.amazon.com/dp/B01II9PHI4 PLEASE, USE THE HEADPHONES! 00:00 - 01:28 - Introduction (Whisper ENG) 01:29 - 18:42 - Unboxing with tapping, scratching, rubbing, rustling and items showing 18:43 - 41:50 - Zen G

Dhiyanoiseasmr

ASMR #2 Russian Language Lesson From Native Speaker & Numbers for the Beginners

PLEASE, USE THE HEADPHONES! The second ASMR Russian Lesson is dedicated to numbers and their endings. So, it is a lesson for the beginners and you can skip this part, if this theme is well-known to you :) -------------------------------------------------

Dhiyanoiseasmr

ASMR Cluedo Tracing & Inaudible Close Up Whispering & Mouth Sounds (Inaudible Whisper)

PLEASE, USE THE HEADPHONES! Tracing became one of my favorites triggers not a long time ago. Also I wanted to try inaudible whispering. I decide to combine these triggers in this video. Let me know what do you think about it :) --------------------------

Dhiyanoiseasmr

Catplant ASMR

Subs(398000) Views(81867396)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Whispered Unboxing w/ Close up Triggers (tapping, scratching + other trigger sounds!)

Can you guess the song? Deezer, a global music streaming service, is giving 20 members of the ASMR community a 6 month Premium code (worth $60). That means unlimited access to music and podcasts with zero ads, free downloads and cool features like Flow, a

Dhiyanoiseasmr

ASMR - Lofi Tapping (random rambling trigger sounds - whispered)

I loveee Helix! Thank you for helping me get better sleep. Visit helixsleep.com/catplant to get up to $200 off your Helix mattress, plus two free pillows.

Dhiyanoiseasmr

ASMR - Soft-Spoken Tapping on Objects that I LOVE (vinyl, dvd, plushies, earrings, video game stuff)

Get 20% OFF + Free Shipping @MANSCAPED with promo code CATPLANT20 at MANSCAPED.com! #sponsored #manscaped

Dhiyanoiseasmr

ASMR with Niamh

Subs(604) Views(25298)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Tapping Empty Things

Hiya lovelies!! Todays video is just lots of tapping on lots of empty things and me whispering along, hope you enjoy :)x I post new videos every Tuesday and Friday at 5:30pm (BST) - please subscribe if you would like to see more! Donations are not expect

Dhiyanoiseasmr

ASMR Lofi - Reading You To Sleep #2 (Soft-Spoken)

Hi lovely people!!! Another reading you to sleep video today with a lofi mic and natural lighting and a mixture of whispers and soft speaking, hope you enjoy :) also I love these stories so much, they remind me of my childhood! let me know what your favour

Dhiyanoiseasmr

ASMR - Useless Facts (Lots Of Whispers)

Hi lovely people!! Hope you enjoy me telling you lots of random useless facts in a nice relaxing whisper?x I post new videos every Tuesday and Friday at 5:30pm (BST) - please subscribe if you would like to see more! Donations are not expected but are

Dhiyanoiseasmr

ChakraBot

Subs(8000) Views(989179)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR: Fabric massage and whisper

Use headphones. ~~~Enjoy~~~

Dhiyanoiseasmr

ASMR: Dry flowers (crinkling, glass tapping, brushing)

The crinkluing is sort of loud through headphones, so listen through speakers first to judge whether or not you want to use them.

Dhiyanoiseasmr

ASMR: Lush catalogue- Page flipping/soft spoken

I haven't uploaded anything other than readings in too long! Here I am going through a Lush catalogue and talking about my choices, or reading their descriptions. A nice long video for you all.

Dhiyanoiseasmr

Celaine's ASMR

Subs(257000) Views(36592470)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Fast & Aggressive Cranial Nerve Exam w/ THE WRONG TOOLS Medical Doctor Roleplay Eye, Light, Ear

ASMR Fast & Aggressive Cranial Nerve Exam w/ THE WRONG TOOLS Medical Doctor Roleplay Eye, Light, Ear. ASMR FAST & AGGRESSIVE Cranial Nerve Exam Doctor Roleplay, Medical Examination, Eye, Light, Ear. ASMR DETAILED Cranial Nerve Exam FAST Medical Role Play,

Dhiyanoiseasmr

ASMR Cranial Nerve Exam with THE WRONG TOOLS #shorts medical examination, eye, muscle, CHAOTIC ✨

ASMR Cranial Nerve Exam with THE WRONG TOOLS #shorts medical examination, eye, muscle, CHAOTIC ✨ #asmrcranialnerveexam #asmrfastandaggressive #shorts

Dhiyanoiseasmr

ASMR Spa Facial Treatment, Layered Sounds, Eyebrow Plucking, Personal Attention & Check In ?

ASMR Spa Facial Treatment, Layered Sounds, Eyebrow Plucking, Personal Attention & Check In ?. Welcome to the more fast pace spa for a dreamy and sleepy peaceful night. This is an asmr video for those who love skincare asmr, a spa facial treatment with a

Dhiyanoiseasmr

KiKi ASMR

Subs(2410) Views(244145)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] RELAXING FOOT & LEGS MASSAGE With LOTION? #ASMR #KiKiASMR #footasmr

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary CUSTOM VIDEOS' E-MAIL : chiaranaomi97@live.it

Dhiyanoiseasmr

ASMR | Pure, Wet Mouth Sounds ✨ #mouthsounds #マウスサウンド #KiKiASMR

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary E-MAIL: chiaranaomi97@live.it Hey ciao, sono Kiki ^-^ come avrai notato questo video (no talking)

Dhiyanoiseasmr

ASMR | RAGAZZA TIMIDA ? Shy girl roleplay | 内気な少女ロールプレイ #Whispering #ASMR #KiKiASMR

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary E-MAIL: chiaranaomi97@live.it Ecco qui le mie PLAYLIST: Mouth Sounds/Kissing Sound | マウスサ

Dhiyanoiseasmr

ASMRrequests

Subs(497000) Views(139123562)

Last Update (07/2021)

Dhiyanoiseasmr

☀️⛱️ Summertime Self-Care | ASMR | Tapping, Scratching, Soft Speaking, Unboxing

**Disclaimer: I’ve partnered with FabFitFun on this video. This is my impression of the FabFitFun box, and all opinions are my own - and I LOVE IT!!!! ? Use my code [ASMR10] for $10 off: https://fabfitfun.com/welcome/ Hello my friends and fellow Ting

Dhiyanoiseasmr

ASMR - ?? Reading You to Sleep - Soft Speaking, Whisper, Tapping, Page Turning

Good evening and happy Easter and Passover, my friends and fellow Tingleheads! I've been feeling kind of sickly over the last week, so I had to take it easy on shooting - but I wanted to make sure to do at least a LITTLE something for y'all...so here ya go

Dhiyanoiseasmr

ASMR - All Up In Your Ears 3 - Ear cleaning, brushing, cupping, personal attention, & more

Good evening, my friends and fellow Tingleheads! It's been a little while, so I thought it was about time for me to get back UP IN YO EARS!! This is a primarily no talking video, with a teensy bit of whispering thrown in. I hope you enjoy! ❤ For those w

Dhiyanoiseasmr

Tishe ASMR

Subs(1510) Views(76142)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - RELAXING NAIL TAPPING SOUNDS (FAST&SLOW)

HI guys! You will see ASMR NAIL TAPPING video and I hope you will like it ❤️PLEASE WATCH TILL THE END❤️ Please support me with your likes and comments! Subscribe to see more videos and don't forget to turn on the notifications. WATCH MY OTHER

Dhiyanoiseasmr

ASMR - BODY SCRATCHING SOUNDS RELAXING FULL OF TINGLES FOR YOUR SLEEP

HI guys! This is longer version of body scratching video so I hope you will like it more than short one) ❤️PLEASE WATCH TILL THE END❤️ There will be RELAXING TINGLY BODY&CLOTHES SCRATCHING SOUNDS FOR YOUR SLEEP. I LOVE THIS SOUNDS SO MUCH! Hope

Dhiyanoiseasmr

ASMR - CLOSE UP. 5 MIN AND YOU WILL FALL ASLEEP. BODY SCRATCHING

HI guys! This is my first short ASMR video with body scratching sounds. I want to test this type of video so will see if you like it or not)) ❤️PLEASE WATCH TIL THE END❤️ There will be CLOSE UP and TINGLY BODY&CLOTHES SCRATCHING SOUNDS. I hope

Dhiyanoiseasmr

Also Maya ASMR

Subs(4770) Views(141048)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Close Whispers & Word Tracing ? (Positive words to make you feel good!) ✨

Hey everyone :3 Tonight we are tracing positive words to brighten your mood and make you feel good! I whisper and trace letter by letter to make you sleepy eheh Hope you enjoy this video! xx _____________________________________ ? My Patreon Family ?

Dhiyanoiseasmr

ASMR to help you with Anxiety | Mic brushing, Close Whispers, Hand movements, Guided Breathing ?

Hi there :3 For today's video I decided to do a very low light environment so we can just relax and be easy on our eyes! Lots of mic brushing, close whispers and some hand movements. I also wanted to help you focus on controlling your breathing and practic

Dhiyanoiseasmr

ASMR | Asking you extremely personal questions! ? (Whispered Roleplay + Keyboard Sounds)

Hi :3 Today I will ask you super personal questions! Keep in mind that these were not targeted at anyone specifically, they are just for the purpose of the video! I've seen some of these videos with questions and I love them so much, so I wanted to do my o

Dhiyanoiseasmr

ASMR DOLL

Subs(145000) Views(23292353)

Last Update (07/2021)

Dhiyanoiseasmr

ZAFUL Summer/Beach Inspired TRY ON HAUL (Close-Up Whispering, Inaudible Mouth/Fabric Sounds)

ONLYFANS: https://onlyfans.com/onlysaba Shop ZAFUL’s 7th Year Anniversary Sale: http://fshion.me/302DWKY USE DISCOUNT CODE “DOLL18” FOR 18% OFF YOUR NEXT PURCHASE ♡ Criss Cross Wrap Crop Top (one size): http://fshion.me/302EljB ♡ Solid Color

Dhiyanoiseasmr

ASMR | Hair brushing / Styling & Life Update! (Tapping, Hand Movements, Rambling)

ONLYFANS: https://onlyfans.com/onlysaba Duvolle® 70% OFF PROMO CODE: ASMRDOLL70 Duvolle® Desire Series Styling Iron: $28.50 https://duvolle.com/desire-series-styling-iron/ ? INSTAGRAM: https://bit.ly/3kTsZmo ? BUSINESS INQUIRIES: asmrsaba@gmail.co

Dhiyanoiseasmr

ASMR | Sneakers Collection (Softly Spoken / Whispered)

☁️ My Patreon is paused for the next few months while I finish school. Working full time and studying is not easy, so thank you for being patient with me! I hope you're healthy and well, dolls. Xo ? INSTAGRAM: https://bit.ly/3kTsZmo ? BUSINESS I

Dhiyanoiseasmr

North Star ASMR

Subs(1700) Views(212246)

Last Update (07/2021)

Dhiyanoiseasmr

My big return to ASMR!!! ?

This video did NOT go as smoothly as planned. Lol. ?? I ran into a lot of problems during filming including my camera not focusing properly + it overheated several times so this took hours to film, which you’ll see I’m filming during the day & at

Dhiyanoiseasmr

Drinking Wine & Talking Movies? (w/ Emmy Award) ASMR

Synopsis: Showing you guys a REAL Emmy Award while drinking wine & talking about movies! **I uploaded this mainly just for fun, to get drunk & ramble on about movies. Thumbs up if you make it through the whole video!! ? ** I don’t really recommend

Dhiyanoiseasmr

ASMR ~ Bubblegum Mixtape

❤ S U B S C R I B E ❤ This is a re-cut of all my previous bubblegum videos... all the best scenes together in one video. Hope you enjoy!

Dhiyanoiseasmr

Olivie

Subs(1130) Views(45698)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Baby Tiger Adoption | Adoption Agency Roleplay | Pet Adoption | Adoption Day

Finally! I am so proud of this roleplay and SO excited for you to watch it! [ASMR] Baby Tiger Adoption | Adoption Agency Roleplay | Pet Adoption | Adoption Day 0:00 - 7:30 Your Application 7:31 - 34:48 Toys&Food 34:49 - 39:10 Baby Tiger Subscribe to

Dhiyanoiseasmr

[ASMR] Nature Sounds | Relaxing Walk | Sounds Of Nature | Walking In The Park Birds Chirping #Shorts

Relaxing birds sounds while walking in a huge park complex pretty near my home. [ASMR] Nature Sound Relaxation | Relaxing Sleep-Bird Chirping Sounds | Soothing Forest Birds Singing Subscribe to become a LOVE GANG Member here: https://www.youtube.com/chann

Dhiyanoiseasmr

[ASMR] Frames Fitting #Shorts | Personal Attention | Glasses Fitting Roleplay

Let me help you see clearer this May with personal attention and frame fitting. [ASMR] Frames Fitting After A Medical Test For Pilot #Shorts | Personal Attention Subscribe to become a LOVE GANG Member here: https://www.youtube.com/channel/UC2EL7x9g9HDEZWU

Dhiyanoiseasmr

Sagris ASMR

Subs(1660) Views(151048)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Vietnam| Kí túc xá Sagris| Nói thì thầm

ASMR Sagris ASMR roleplay Vietnamese ASMR Vietnam ThanhASMR Vietnam ASMR Vietnamese Dorm for students Welcome to Sagris Dorm! I am talking about Sagris Dorm with a lot of good facilities such as accommodation, services, library, entertainment, kitche

Dhiyanoiseasmr

ASMR Greek| Day Month and Year| ημέρα μήνα και έτος| Sagris

Sagris ASMR ASMR whispering Asmr whisper ASMR GREEK GREEK ASMR Greece asmr Asmr greece Day, Month and Year Today, I’d like to talk about Day, Month and Year in Greek and how to know which months have 30 or 31 days I hope you like my Greek Thank you

Dhiyanoiseasmr

ASMR Vietnam| Makeup you| Trang Điểm bạn| Lots of Personal Attention | Sagris

Time stamp 00:00 greeting - lời chào 01:07 remove makeup - Tẩy trang 04:38 wipe face - lau mặt 06:07 touch hair - xoã tóc 06:20 brush hair - chải tóc 08:26 hair cut - cắt tóc 10:48 brush face - phủi tóc 12:54 clean face - lau mặt

Dhiyanoiseasmr

Lottie K ASMR

Subs(7890) Views(160334)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Latex Glove Sounds & Hand Movements

Hi Everyone. I hope this video helps you relax and sleep well tonight :) ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) paypal.me/lottiekasmr Goodnight x #lottiekasmr

Dhiyanoiseasmr

ASMR Fixing you | Random Mechanic Roleplay

Hi Everyone. I hope this video helps you relax and sleep well tonight :) ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) https://www.paypal.com/paypalme/lottiekasmr Goo

Dhiyanoiseasmr

ASMR Photoshoot, doing your hair & make up

Hi Everyone. I hope this video helps you relax and sleep well tonight :) Sorry I'm a bit out of practice ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) https://www.paypa

Dhiyanoiseasmr

SingStar ASMR

Subs(442) Views(66294)

Last Update (07/2021)

Dhiyanoiseasmr

Eating Corn Cakes and Peanut Butter | Whispering | SingStar ASMR

Crunchy Corn Cake eating ASMR video... Enjoy! SS SUBSCRIBE and Click the BELL to get notified when i have a new video!!

Dhiyanoiseasmr

DOCTOR WHO, SONIC SCREWDRIVER ASMR & WHISPERS and Mic Scratching! Singstar ASMR

SONIC SCREWDRIVER ASMR and whispered chat. Trigger tingles!! Welcome... BIG TINGLES for you!! Maybe to a little soft singing too? SS Twitter @singstarASMR Insta singstar_asmr

Dhiyanoiseasmr

Carpet Scratching | REQUEST VIDEO | NO TALKING | SingStar ASMR

A request ASMR video, Carpet rubbing and Scratching... Enjoy! SS SUBSCRIBE and Click the BELL to get notified when i have a new video!!

Dhiyanoiseasmr

Zeri ASMR

Subs(39100) Views(4636452)

Last Update (07/2021)

Dhiyanoiseasmr

BRUSHING #SHORTS | Zeri ASMR

Dhiyanoiseasmr

EXAMEN DE LOS NERVIOS CRANEALES | SOFT SPOKEN | ROLEPLAY MÉDICO | ASMR Español

¡Hola! Bienvenido a mi canal, yo soy Lorena Zeri y aquí hago ASMR, si te gusta recuerda que puedes suscribirte y darle like? Mis redes sociales: Twitter: @lorenazeri https://twitter.com/lorenazeri Instagram: @lalorenazeri https://www.instagram.com/

Dhiyanoiseasmr

DEJO EL ASMR PARA SER LA CUARTA POLINESIA

¡Hola! Bienvenido a mi canal, yo soy Lorena Zeri y aquí hago ASMR, si te gusta recuerda que puedes suscribirte y darle like? Mis redes sociales: Twitter: @lorenazeri https://twitter.com/lorenazeri Instagram: @lalorenazeri https://www.instagram.com/

Dhiyanoiseasmr

ASMR Star

Subs(71000) Views(6321681)

Last Update (07/2021)

Dhiyanoiseasmr

BTS (방탄소년단) Butter but in ASMR

?Instagram: theasmrstar ?Custom videos: www.wisio.com/ASMRStar For inquiries: asmrstar4@gmail.com

Dhiyanoiseasmr

Need To Know by Doja Cat but ASMR

For inquiries: asmrstar4@gmail.com ?Instagram: theasmrstar ?Custom videos: www.wisio.com/ASMRStar

Dhiyanoiseasmr

Yonaguni by Bad Bunny but ASMR

?Instagram: theasmrstar ?Custom videos: www.wisio.com/ASMRStar For inquiries: asmrstar4@gmail.com

Dhiyanoiseasmr

LunaRexx ASMR

Subs(162000) Views(20984573)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Black Widow Calms YOU Down ? (Face Touching & Soft Spoken, Up Close Personal Attention)

Shh I am here to calm you down tonight. If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PATREON (60+ EXCLUSIVE ASMR VIDS & COSPLAY) ? https://www.p

Dhiyanoiseasmr

ASMR Tattoo Tracing on my Body to Give YOU Tingles ✏️? (Skin Sounds, Visual Triggers, Whispered)

I hope you like my new ink ? Enjoy this tingly experience. Thanks for watching! If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PATREON (60+ EXCLUS

Dhiyanoiseasmr

ASMR FOLLOW MY SIMPLE INSTRUCTIONS...again ?? (for Sleep & Tingles)

You must listen and follow all of my instructions, I promise you will sleep. Thanks for watching! If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PAT

Dhiyanoiseasmr

kkybik ASMR

Subs(3860) Views(689290)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Boyfriend Roleplay // sign language

Girls, next time lets try to be more peaceful in nervous situation with your boyfriend. This ASMR role play special for you! https://vk.com/m.novelisky - я ВК https://www.instagram.com/novelisky/ - инстаграм

Dhiyanoiseasmr

АСМР мешок для удовольствий!

Я нашел эту небольшую сумку с разными предметами для АСМР... давайте заглянем? https://vk.com/m.novelisky - я ВК https://www.instagram.com/novelisky/ - инстаграм

Dhiyanoiseasmr

Новогодний АСМР!!! Новогодняя АСМР ночь.

Дорогие друзья! Поздравляю Вас с 2017 годом. Желаю всего самого наилучшего. Любите и проявляйте заботу друг к другу - в этом смысл жизни. Спасиб

Dhiyanoiseasmr

Bible ASMR

Subs(543) Views(10044)

Last Update (07/2021)

Dhiyanoiseasmr

Bible ASMR Exodus 25-28ㅣIs God being Fussy?

Hey guys it's good to be back! Thank you for all of your messages I like reading them in my spare time on the train or at home! We are reading a long section of descriptive words about the Tabernacle. I think it helps to have a picture of it as we read so

Dhiyanoiseasmr

Bible ASMR Exodus 20-24 l Normal Reading/10 commandments/What does God want?

Hello everyone! the weather in London is improving but I've been feeling lazy recently. I went to the post office today to send off documents for the GDC application (dental governing body in UK). I have also been binging "How I met your mother" which is

Dhiyanoiseasmr

Update from 30 June 2021

Hello all! It feels good to communicate with you guys again. In this video I highlight what has been going on in my life. I also shout out your lovely comments! Hope you have a wonderful week and see you all soon!

Dhiyanoiseasmr

DuckMarbles ASMR

Subs(2310) Views(155667)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Medical Roleplay- Nervous and Tired Nurse Helps On His First Day

I wanted to switch things up and do something a little bit different than the regular medical videos I do! I left a poll to decide between this or a comfort video, so next week will be some comfort ASMR! Also please excuse the sunbirn...it kinda looks lik

Dhiyanoiseasmr

When You Try To Make A Video, But Get Distracted

I sat down to make a video and....well.....I got side tracked....

Dhiyanoiseasmr

ASMR Barber Roleplay- Giving You A Haircut (with background storm sounds)

snip snipsnip snipsnipsnip snipsnipsnipsnip snipsnipsnipsnipsnip snipsnipsnipsnipsnipsnip snipsnipiloveyousnipsnipsnip snipsnipyouresuchacutiesnipsnip snipsnipsnipwinkyfacesnipsnipsnipsnip __________________________________________________ If you enjoy

Dhiyanoiseasmr

SophiaChristina ASMR

Subs(6590) Views(1181351)

Last Update (07/2021)

Dhiyanoiseasmr

Greek ASMR | Makeup Artist Roleplay

#greekasmr #ελληνικοασμρ Follow me on instagram: @sophiachristinaasmr

Dhiyanoiseasmr

Greek ASMR | Summer Outfits Show & Tell

#greekasmr #ελληνικοασμρ Follow me on Instagram! @sophiachristinaasmr

Dhiyanoiseasmr

HUGE GREEK ASMR COLLAB | Personal attention, whispering, tapping, scratching, and many more...)

#greekasmr Biggest Greek Collab Ever made ! Hope you enjoy ❤️ Don't forget to check Out the channels ❤️ Channel Links: 0:00:00 SophiaChristina ASMR https://www.youtube.com/watch?v=je6ypgw-E4M 0:03:24 Jolly Roger ASMR https://www.youtube.com/wat

Dhiyanoiseasmr

Whisperwind ASMR

Subs(7250) Views(583685)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | The Peddler Helps You on Your Quest | Into the Forest, Part I

Zot the peddler has returned, so you approach her to return the valuable crest you borrowed from her previously. What else might she have to offer you today? This video is the beginning of a new adventure! Subscribe to catch the whole story! New to the

Dhiyanoiseasmr

ASMR Black Widow Gives You a Checkup | Checking You for a Concussion

You've been recruited as a new initiate into the Avengers! You've been put through rigorous training to determine your skills, and you took a hit in an exercise earlier today. Black Widow is here to look you over and make sure you're okay! ASMR check up,

Dhiyanoiseasmr

ASMR Vampire Interviews You For Her Faction | Ronnie the Protector

So you wanna be a vampire, huh? Well, thanks to the Institute, qualified candidates can go through an extensive screening process to make all your undead dreams come true! You've jumped through all the hoops, and there's only one thing left to do: you need

Dhiyanoiseasmr

iPad ASMR

Subs(3800) Views(63017)

Last Update (07/2021)

Dhiyanoiseasmr

?iPad ASMR - ?Kings And Queens of England? - Henry II (5/42)

Hello friends! Today we are continuing learning about the Kings and Queens of England! Today we are looking at Henry II. I hope that you will find this relaxing as well as informative! Please dont forget to like this video, leave a comment and subscribe!

Dhiyanoiseasmr

?iPad ASMR -❓What's on my iPad?❓Part #3

Part 1: https://youtu.be/y_Kdr3OP8fI Part 2: https://youtu.be/ve0WAODn_9s My Main ASMR Account - https://www.youtube.com/whisperaudiosasmr Products used: -iPad Air 2020 (10 inch, Rose Gold) -Apple Pencil 2nd generation -Goodnotes app -Screen protector -

Dhiyanoiseasmr

?iPad ASMR -❓What's on my iPad?❓Part #2

Part 1 can be viewed here : https://youtu.be/y_Kdr3OP8fI Please dont forget to like this video, leave a comment and subscribe! My Main ASMR Account - https://www.youtube.com/whisperaudiosasmr Products used: -iPad Air 2020 (10 inch, Rose Gold) -Apple P

Dhiyanoiseasmr

DireHit ASMR

Subs(121000) Views(16545803)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Doctor Cranial Nerve Exam Male Roleplay For Sleep & Anxiety (Ear Eye Exam Hearing Test Light)

ASMR Doctor Cranial Nerve Exam Male Roleplay For Sleep & Anxiety (Ear Eye Exam Hearing Test Light). I will examine the 12 cranial nerves with examinations for your medical procedure. Your Asmr exam rp will include hearing test, realistic exam, questions, N

Dhiyanoiseasmr

ASMR Fast & Aggressive Doctor Cranial Nerve Exam #shorts Roleplay

ASMR Fast & Aggressive Doctor Cranial Nerve Exam #shorts Roleplay. You just came in the doctor express line for your cranial nerve exam because you don't have much time. here we go Full Length Relaxing Cranial Nerve Exam: https://youtu.be/gMWGH47fYak If

Dhiyanoiseasmr

ASMR Realistic Haircut & Shave Barbershop Roleplay For Men (Clipper, Spray Bottle & Layered Sounds)

ASMR Realistic Haircut & Shave Barbershop Roleplay For Men (Clipper, Spray Bottle & Layered Sounds). Trim, Scissors, Razor, Face Touching Personal Attention Hair Care Beard Clean up. Today you guys are all male and you need a haircut because you haven't go

Dhiyanoiseasmr

Steven ASMR

Subs(57100) Views(7623626)

Last Update (07/2021)

Dhiyanoiseasmr

Papa Is Home DDLG 18+ ASMR

https://www.instagram.com/steven_panda1989/

Dhiyanoiseasmr

Let Daddy Comfort You ASMR DDLG 18+

https://www.instagram.com/steven_panda1989/ Merch Store: https://shop.spreadshirt.com/undead-psycho-panda-army-shop

Dhiyanoiseasmr

Sweet Daddy Aftercare DDLG 18+ ASMR

https://www.instagram.com/steven_panda1989/ Steven ASMR Shop: https://shop.spreadshirt.com/undead-psycho-panda-army-shop/all #PsychoPandaArmy #DDLG #Aftercare

Dhiyanoiseasmr

ASMRWithOllie

Subs(13200) Views(1658529)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] COVID-19 Test Roleplay | Medical Doctor Coronavirus | Soft Spoken Personal Attention & Gloves

Hello! It's been a fair while since my last upload - the whole audiobook debacle sent me into a bit of a tailspin and I feel like the first part of this video wasn't as "ASMR-esque" as I would have liked but when it gets into the testing part I'm quite hap

Dhiyanoiseasmr

[ASMR] Wrapping Christmas Presents With Your Boyfriend Roleplay

Hello! This was... a long video to edit - I was in two minds about actually uploading it if I'm honest, mostly due to the echo but I felt like the wrapping sounds were super loud too. In the end, I decided I'd leave the decision up to you! If you don't fin

Dhiyanoiseasmr

[ASMR] Ramble With A Tiny $1 Microphone

Hello! Check out the Santa Christmas Subway Run game on IOS (and Google Play soon). There's a link below as well - this video is a bit of nonsense but I hope you enjoy it! The triggers in this video are literally just soft speaking, some whispering and a

Dhiyanoiseasmr

Moonlit Bible ASMR

Subs(2160) Views(185196)

Last Update (07/2021)

Dhiyanoiseasmr

Slow, Soft Whisper, Tapping, & Layered Sounds For Sleep ✞ The Armor of God ✞ Whisper Bible ASMR

I had to take down this video and re-upload it due to an error discovered by a kind viewer who pointed it out to me! I pray you are blessed by this! In this video we will learn how wearing the Belt of Truth will guard a Christian from the lies and dec

Dhiyanoiseasmr

The Armor of God – Belt of Truth ✞ Slow, Soft Whisper Bible ✞ Study of Ephesians 6 ✞ Christian ASMR

In this video we will learn how wearing the Belt of Truth will guard a Christian from the lies and deceits of Satan, false teachers, and false beliefs. We will also see how we can resist and stand firm against the enemy’s attacks, and come out victoriou

Dhiyanoiseasmr

Victory Over Spiritual Battles ✞ Whisper Bible ASMR ✞ Christian ASMR ✞ Ephesians 6

What a triumph there is for those of us in Christ! I had a renewal of spiritual zeal making this video! Discovering the victory that is ours through the simple choice of just standing firm in the strength of the Lord is thrilling and invigorating to the

Dhiyanoiseasmr

Scooperdoodle ASMR

Subs(7250) Views(670669)

Last Update (07/2021)

Dhiyanoiseasmr

Kitten Purring ASMR (old school)

Please enjoy the soothing sounds of my cat, Brie, purring

Dhiyanoiseasmr

Old School ASMR Antique Hand Crank Sewing Machine *No Talking* Scooperdoodle ASMR

Hello friends! This video is purely selfish, because I wanted it :) Here is an extended, sewing-only video with my antique 1930’s Hand Crank Singer 99k sewing machine! (I really love this thing)

Dhiyanoiseasmr

Old School ASMR Vintage Hand Crank Sewing Machine Test *No Talking* Scooperdoodle ASMR

Hello all, long time no see! I figured I’d kick off my return with an old school cellphone ASMR video. I don’t have a laptop anymore, so unfortunately this will have to do. In this video I’m making a scrunchie (minus the finishing touches) out of s

Dhiyanoiseasmr

Enny ASMR

Subs(2580) Views(231346)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Ťukanie na dobrú noc ?

Ahojte kamaráti,?‍♀️ pripravila som si pre vás video s rôznymi príjemnými zvukmi nech rýchle zaspíte a ráno vstávate svieži a oddychnutí. Dobrú noc, Enny.? ?️Páčil sa ti edit v tomto videu? ?️ Edituje ho veľmi šiko

Dhiyanoiseasmr

ASMR - Diamond painting | Satisfing sound

Ahojte kamaráti,?‍♀️ mám pre vás hypnotizujúce video s príjemným zvukom diamantového obrázku. Nechám vám aj link kde sa dá takýto obrázok kúpiť: https://a.aliexpress.com/_mNZYmy5 Je to celkom príjemná zábava, ale úplný zabij

Dhiyanoiseasmr

ASMR v zubnej ambulancií

Ahojte kamaráti,?‍♀️ urobila som vám také krátke mini video z ambulancie. Nieje to roleplay ako ste si žiadali, ale myslím, že lepšie ako nič. Nepripravovala som toto video dopredu, bolo to spontánne a vravím to preto, lebo neviem či v

Dhiyanoiseasmr

Jessica Christine ASMR

Subs(321) Views(10339)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Up Close, Ear To Ear, Relaxing, Inaudible Whispers | Slow Hand Movements | Sleepy Mic Brushing!

Hi guys welcome to my ASMR channel! This video was made to help YOU relax and sleep. In this video I do up close slow, breathe-y, ear to ear whispers! This is the ultimate video for sleep. The first half I do relaxing semi inaudible whispers & second half

Dhiyanoiseasmr

KYLIE JENNER'S FRIEND DOES YOUR MAKEUP | ASMR | Personal Attention | Sassy ASMR | Makeup Application

Hi guys welcome to my ASMR channel! This video was made to help YOU relax and sleep. In this video I do a role-play of being one of Kylie Jenner's best friends. Me and you both live in the hidden hills in Calabasas, CA where Kylie lives. You want me to do

Dhiyanoiseasmr

ASMR URTHBOX UNBOXING VIDEO VEGAN SNACK BOX | Object Tapping, Crinkles, Scratching | Whispering Zzzz

Urthbox (non-affiliate link) just here if you guys wanna try! https://www.urthbox.com *If you are a business/company who would like to contact me about business inquiries...please email me at: jessicachristineasmr@gmail.com ---- Follow me on my social

Dhiyanoiseasmr

TingleFairy ASMR

Subs(478) Views(24898)

Last Update (07/2021)

Dhiyanoiseasmr

*ASMR* Tapping Sounds for Insomnia | NO TALKING

Hi everyone, My upload schedule has been a bit all over the place recently so apologies for that! In this video I share some lovely gifts I received for my birthday and explore different sounds with the items. there is no talking in this birthday asmr hau

Dhiyanoiseasmr

*ASMR* Gentle Rain and SLOW Hand Movements

*ASMR* Gentle Rain and SLOW Hand Movements Hi everyone! In today's video I share some gentle pattering rain sounds which are my absolute favourite sound to listen to! Throughout the video I do super slow hand movements and whisper every now and then. I'm

Dhiyanoiseasmr

*ASMR* My 5 Favourite Sleepy Triggers ?

*ASMR* My 5 Favourite Sleepy Triggers ? Hi everyone! In todays video I share 5 of my favourite sleepy triggers. These include rain sounds, hand movements, mouth sounds, scratching on clothes and rustling hair, and personal attention. I hope you enjoy

Dhiyanoiseasmr

Atmosfera ASMR

Subs(11000) Views(373409)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Dentista Atencao Pessoal Atmosfera Asmr Roleplay

ASMR Dentista Voz suave Roleplay Atmosfera Asmr Video de ASMR com voz suave para relaxar sentir arrepios e dormir rapido. Sons relaxantes oara dormir Asmr com roleplay atencao pessoal dentista atendendo voce sm relaxante teclado scratching Asmr soft spoken

Dhiyanoiseasmr

ASMR Lendo para voce dormir Chuva SUSSURROS Reading Whispering

ASMR Lendo para voce dormir SUSSURROS Video de ASMR com leitura sussurrando de orelha a orelha para relaxar ter arrepios e dormir rapido. Asmr ear to ear com sussurros e lendo livro. Asmr lendo para dormir Video de Asmr para relaxar arrepiar com leitura

Dhiyanoiseasmr

ASMR COMPRINHAS Sussurros intensos para dormir Atmosfera Asmr

ASMR COMPRINHAS Sussurros intensos para dormir Atmosfera Asmr Video de Asmr mostrando comprinhas com sussurro intenso para relaxar arrepiar e dormir rapido. Asmr sussurrando no seu ouvido para relaxar e dormir em poucos minutos. Video mostrando objetos de

Dhiyanoiseasmr

Sensory ASMR

Subs(36300) Views(3269431)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR #Storytime - Los LADRONES DEFECADORES?? (ASMR Español Argentina) / Anecdota

Hola! Como va? En el video de hoy les cuento un poco cuando entraron a "robar" en mi laburo! Espero que les guste y que les ayude a relajarse! -Seguime en Instagram: https://www.instagram.com/sensory_asmr/ , Es donde mayormente estoy activo ademas de yout

Dhiyanoiseasmr

ASMR PROBANDO ALFAJORES ??CUAL es el mas RICO? (ASMR Español Argentina)

Hola! Como andan? En el asmr de hoy vamos a probar alfajores de diferentes marcas! Y tambien una variedad rara de alfajores con sabor a cerveza! Si les gusta no olviden reventarlo a likes y comentar! Los voy a estar leyendo! -Seguime en Instagram: https:

Dhiyanoiseasmr

ASMR Gameplay - SUSURRANDO en RESIDENT EVIL VILLAGE?(Asmr Español)

Hola! Como les va? En el asmr de hoy les traigo un rato de Resident evil 8(Village) Espero que les guste y que se puedan relajar! -Seguime en Instagram: https://www.instagram.com/sensory_asmr Es donde mayormente estoy activo ademas de youtube! -Recuerd

Dhiyanoiseasmr

The Velvet Whisperer ASMR

Subs(26000) Views(2391434)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Story Time / Recap / Up Close - like, real close, lol

Let's get into this story time / recap of the last two videos! Headphones, please :-) Comment, like, share, subscribe, and turn on notifications! ;-) "Tip Jar" (If you feel inspired - any donation is greatly appreciated!) Venmo: @mikewb or CashApp: $Mike

Dhiyanoiseasmr

Come get FITTED on the UNDERGROUND MARKET | ASMR Role Play

Velvet gang! Grab those headphones and join me in this dark room so you can get your fitting :-D Comment, like, share, subscribe, and turn on notifications! ;-) "Tip Jar" (If you feel inspired - any donation is greatly appreciated!) Venmo: @mikewb or Ca

Dhiyanoiseasmr

ASMR Roleplay: Physical Exam on the Black Market

Velvet gang! In the previous video (https://youtu.be/9cDb6cJWMdA), you were interviewed to gain access into the Black Market Gym. You were informed you needed a physical to complete your admission process. Here we are :) Grab those headphones! Comment, li