Dhiyanoiseasmr

ASMR N-GAZE

Subs(564) Views(56466)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Thai - Whispering - Mic Brushing - Ear Cleaning - 2021 June Compilations | N-GAZE

Welcome to ASMR N-GAZE ? Whisper Trigger Tapping etc. Anything Tingles ASMR Thai - Whispering - Mic Brushing - Ear Cleaning - 2021 June Compilations | N-GAZE My nick name is Note. I'm from thailand. Hope you enjoy and relax. Headphones or Earphones

Dhiyanoiseasmr

ASMR Thai - Whispering - Product's Name | N-GAZE

Welcome to ASMR N-GAZE ? Whisper Trigger Tapping etc. Anything Tingles ASMR Thai - Whispering - Product's Name | N-GAZE My nick name is Note. I'm from thailand. Hope you enjoy and relax. Headphones or Earphones for the best. ? Thank You for yo

Dhiyanoiseasmr

ASMR Thai - Whispering - Are human beings naturally Lazy? | N-GAZE

Welcome to ASMR N-GAZE ? Whisper Trigger Tapping etc. Anything Tingles ASMR Thai - Whispering - Are human beings naturally Lazy? | N-GAZE My nick name is Note. I'm from thailand. Hope you enjoy and relax. Headphones or Earphones for the best. ?

Dhiyanoiseasmr

ASMattR ASMR

Subs(171000) Views(36389138)

Last Update (07/2021)

Dhiyanoiseasmr

A Livestream for ASMR Previously Run by ASMattR of An Airport for Aliens Currently Run by Dogs

In this ASMR livestream, I softly speak and whisper while playing An Airport for Aliens Currently Run by Dogs. Get ready to watch me pet some stock photos of dogs!!! Twitter - https://twitter.com/ASMattR Facebook - https://facebook.com/ASMattRpublic Insta

Dhiyanoiseasmr

ASMR | SCP-3943: "Taco Man" - A Binaural SCP Reading

Hey everyone! In this binaural ASMR video, I softly speak and whisper into your ears about SCP-3943, a taco vendor who somehow became stuck halfway into the side of an office building along with his taco cart. I hope you'll enjoy it! This video is based o

Dhiyanoiseasmr

[ASMR] Let's Build a Theme Park! RollerCoaster Tycoon 2 Soft-Spoken Gameplay

Hey everyone! In this ASMR video, I build a theme park in the classic PC game RollerCoaster Tycoon 2 while giving soft-spoken commentary. I hope you'll enjoy it! Interested in supporting my channel? Feel free to check out my Patreon page!: https://patreon

Dhiyanoiseasmr

Vida. ASMR

Subs(125) Views(4884)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Eating Chicken Leg Piece, Curry, Rice and Papad || Eating Sounds

Don't Forget to like and subscribe to my channel. ***This is an ASMR video. To ensure all tingles please wear headphone. If you do not enjoy EATING SOUNDS and light whispers PLEASE DO NOT WATCH IT. Eating, chewing, gulping sounds etc...are done very loudl

Dhiyanoiseasmr

ASMR Eating Egg Curry Rice, Papad and Sweet Desert Halwa

ASMR Eating Egg Curry Rice, Papad and Sweet Desert Halwa Don't Forget to like and subscribe to my channel. ***This is an ASMR video. To ensure all tingles please wear headphone. If you do not enjoy EATING SOUNDS and light whispers PLEASE DO NOT WATCH IT.

Dhiyanoiseasmr

ASMR RAJMA CHAWAL || EATING SOUNDS

ASMR Rajma Chawal eatingh sounds Don't Forget to like and subscribe to my channel. ***This is an ASMR video. To ensure all tingles please wear headphone. If you do not enjoy EATING SOUNDS and light whispers PLEASE DO NOT WATCH IT. Eating, chewing, gulping

Dhiyanoiseasmr

DeesSofterSide

Subs(4940) Views(776404)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Whisper Show and Tell- My Shot Glass Collection

I have collected shot glasses for a few years now and so I wanted to feature some in a whisper for you to enjoy. I hope you like it, Sleep Sweet Everyone!

Dhiyanoiseasmr

Whisper Catching Up, I've Missed You Guys!

Thank you for all your patience with me over the years! I've finally invested a bit of money into recording with more than just my iPhone. This will help me to stay more consistent. I hope you enjoy catching up with me a bit. Please comment any requests, h

Dhiyanoiseasmr

ASMR Whisper Sign Language Fingerspelling Lesson

Hi strangers! lol. I am trying to get back into this and thought it would be fun to teach you all how to fingerspell. I hope you enjoy this video, sorry if the editing is weird. I also referenced TheLyricalWhispers. Check him out. Hes awesome. Enjoy! Sleep

Dhiyanoiseasmr

ASMR Eating

Subs(7430) Views(2634613)

Last Update (07/2021)

Dhiyanoiseasmr

Проверка связи))

Dhiyanoiseasmr

ASMR Eating - Dumplings / Mousse cake / Cheesecake / АСМР Итинг - Манты/ Муссовое пирожное / Чи?

Если кто-то желает задонатить на развитие канала)) 4274 3200 7242 7811 ASMR, ASMR eating, ASMR Eating Swedish candy, ASMR Eating Marshmallows, ASMR Eating Marmalade, Muckbang, ASMR Relax, ASMR Whisper, ASMR Whisper

Dhiyanoiseasmr

ASMR - Посылка из Англии UNBOXING ASMR Eating Candy Chocolat АСМР Итинг Конфеты

Если кто-то желает задонатить на развитие канала)) 4274 3200 7242 7811 ASMR, ASMR eating, ASMR Eating Swedish candy, ASMR Eating Marshmallows, ASMR Eating Marmalade, Muckbang, ASMR Relax, ASMR Whisper, ASMR Whisper

Dhiyanoiseasmr

Moonlit Bible ASMR

Subs(2160) Views(185196)

Last Update (07/2021)

Dhiyanoiseasmr

Slow, Soft Whisper, Tapping, & Layered Sounds For Sleep ✞ The Armor of God ✞ Whisper Bible ASMR

I had to take down this video and re-upload it due to an error discovered by a kind viewer who pointed it out to me! I pray you are blessed by this! In this video we will learn how wearing the Belt of Truth will guard a Christian from the lies and dec

Dhiyanoiseasmr

The Armor of God – Belt of Truth ✞ Slow, Soft Whisper Bible ✞ Study of Ephesians 6 ✞ Christian ASMR

In this video we will learn how wearing the Belt of Truth will guard a Christian from the lies and deceits of Satan, false teachers, and false beliefs. We will also see how we can resist and stand firm against the enemy’s attacks, and come out victoriou

Dhiyanoiseasmr

Victory Over Spiritual Battles ✞ Whisper Bible ASMR ✞ Christian ASMR ✞ Ephesians 6

What a triumph there is for those of us in Christ! I had a renewal of spiritual zeal making this video! Discovering the victory that is ours through the simple choice of just standing firm in the strength of the Lord is thrilling and invigorating to the

Dhiyanoiseasmr

ASMR Art of Sound

Subs(129000) Views(19059057)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 8D Mic Scratching w/Spoolie and Slow Whispering [Around Your Head]

In this ASMR: slow whispering in 8D style around your head with mic scratching using a silicone spoolie and nails. What's your fave: 8D pure whispering or 8D whispering combined with some triggers (suggest yours)? ⭐ More 8D ASMR: https://youtube.com/play

Dhiyanoiseasmr

ASMR Ear Cleaning 8D + 3D Binaural [Around Your Head + Through Your Brain]

In this ASMR, I combined 2 ear cleaning/inner ear digging tracks (with silicone spoolies!): 8D around your head sound and a regular 3Dio binaural/ 3D kind of audio. This way, the sound travels around you and through your brain at the same time to create a

Dhiyanoiseasmr

ASMR Intense Mic Scratching - NO COVER - Deep Whispering

In this ASMR: deep and bassy ear play with mic scratching and no cover on. Scratching includes: metal mic mesh, rhinestones around the mic and spider mounts. Plus ear to ear whispering, of course! This is a little bit of a rough/aggressive trigger for thos

Dhiyanoiseasmr

Whisperlodge ASMR

Subs(3580) Views(228215)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Unboxing Very Special Beer (Cardboard, Tape, Packing Peanuts, Glass)

Whisperlodge is currently featured on the label of Vedett Beer, as part of their campaign, Celebrating the Sttupid. The concept is that no idea is stupid and it takes courage to try something new! It might seem strange at first, but it may just succeed! I

Dhiyanoiseasmr

ASMR | Childhood Toys | Cleaning Sylvanian Families Calico Critters Collection

I found my stash of Sylvanian Families toys in a sad paper bag in the storeroom. Here's me taking them out and cleaning each individual part. *EXCITING NEWS* I'm doing an ASMR livestream performance on Twitch on Oct 24! It's commissioned by ArkDes, the n

Dhiyanoiseasmr

ASMR | Virtual Festival Guide | 4th Biennial Singapore Literature Festival in NYC

This performance was commissioned for the 4th Biennial Singapore Literature Festival in NYC and premiered at the Festival Preview on Sep 24, 2020. The Festival runs from Oct 1-3, 2020 and all events are free! More info and RSVP at https://singaporeunbound.

Dhiyanoiseasmr

iPad ASMR

Subs(3800) Views(63017)

Last Update (07/2021)

Dhiyanoiseasmr

?iPad ASMR - ?Kings And Queens of England? - Henry II (5/42)

Hello friends! Today we are continuing learning about the Kings and Queens of England! Today we are looking at Henry II. I hope that you will find this relaxing as well as informative! Please dont forget to like this video, leave a comment and subscribe!

Dhiyanoiseasmr

?iPad ASMR -❓What's on my iPad?❓Part #3

Part 1: https://youtu.be/y_Kdr3OP8fI Part 2: https://youtu.be/ve0WAODn_9s My Main ASMR Account - https://www.youtube.com/whisperaudiosasmr Products used: -iPad Air 2020 (10 inch, Rose Gold) -Apple Pencil 2nd generation -Goodnotes app -Screen protector -

Dhiyanoiseasmr

?iPad ASMR -❓What's on my iPad?❓Part #2

Part 1 can be viewed here : https://youtu.be/y_Kdr3OP8fI Please dont forget to like this video, leave a comment and subscribe! My Main ASMR Account - https://www.youtube.com/whisperaudiosasmr Products used: -iPad Air 2020 (10 inch, Rose Gold) -Apple P

Dhiyanoiseasmr

MissASMR

Subs(258000) Views(70507703)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Oh Yes I love It? Tiiingly Whispers ft Dossier

Dossier has a welcome offer of up to %20 on the website. You can get up to 30% off for your first order by using the discount code - Missasmr10 - http://bit.ly/3bWGEb9 Hey guys! Welcome to another asmr favourites where I will show you my favorites with cl

Dhiyanoiseasmr

ASMR Traitement Du Visage RolePlay ~ ASMR Français ?

Salut mes amours! Voici une nouvelle vidéo asmr français tellement improvisee! j’espère que vous allez aimer la vidéo et que ça vous donnera de la relaxation ❤️ abonnez -vous a ma chaine de vlog - https://bit.ly/3dhSL28 Hey loves! This is a ne

Dhiyanoiseasmr

ASMR Relaxing Whisper & Kiss Sounds ? BIG NEWS - New Mic Test Tonor Q9

Hello ASMR family! Links and discount code for the Tonor mic - https://bit.ly/3cTtko0 https://amzn.to/2Rb2qAG and get 15% off with the code TONORQ9MIC This asmr video is whisperer and I used a new microphone for this video. Hope you will like the sound. F

Dhiyanoiseasmr

The Inaudible Whisperer

Subs(1480) Views(136734)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR- Helping You Cheat On A Test

I would like to thank Mia ASMR, Southern ASMR Sounds, and Grace V for this video idea. Don’t forget to check theirs out if you haven’t already I hope you enjoy. #asmr #asmrtingles #mouthsounds #satisfying #relax #sleep #whispering

Dhiyanoiseasmr

ASMR With A Cup

Tapping, brushing, and scratching on a cup with the mic inside. Hope you all enjoy ? #asmr #asmrtingles #mouthsounds #satisfying #relax #sleep #whispering #minimic

Dhiyanoiseasmr

ASMR- Mini Mic Brushing, Face Brushing, and Mouth Sounds

Face and mic brushing with some mouth sounds for your relaxation. ❤️ Also thanks for 1,000!

Dhiyanoiseasmr

Velvet Whisper

Subs(11400) Views(1131231)

Last Update (07/2021)

Dhiyanoiseasmr

❄ Snow White ❄ ASMR Whispered Fairy Tale Reading

❁ Email: velvetwhisperasmr@gmail.com ❁ Patreon: https://www.patreon.com/user?u=961374 ❁ Paypal: kantolover@gmail.com ❁ Instagram: https://www.instagram.com/_vvvictoria/ (be warned this is my "personal" instagram, so it's just cat pics, concert pi

Dhiyanoiseasmr

ASMR ?Mic Brushing & Scratching (No Talking)

❁ Email: velvetwhisperasmr@gmail.com ❁ Patreon: https://www.patreon.com/user?u=961374 ❁ Paypal: kantolover@gmail.com ❁ Instagram: https://www.instagram.com/_vvvictoria/

Dhiyanoiseasmr

✺ ASMR Fairy Tales ✺ Whispered Rapunzel Reading

tfw when you forget to take a thumbnail picture ❁ Email: velvetwhisperasmr@gmail.com ❁ Patreon: https://www.patreon.com/user?u=961374 ❁ Paypal: kantolover@gmail.com ❁ Instagram: https://www.instagram.com/_vvvictoria/ (be warned this is my "pers

Dhiyanoiseasmr

Jessica Christine ASMR

Subs(321) Views(10339)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Up Close, Ear To Ear, Relaxing, Inaudible Whispers | Slow Hand Movements | Sleepy Mic Brushing!

Hi guys welcome to my ASMR channel! This video was made to help YOU relax and sleep. In this video I do up close slow, breathe-y, ear to ear whispers! This is the ultimate video for sleep. The first half I do relaxing semi inaudible whispers & second half

Dhiyanoiseasmr

KYLIE JENNER'S FRIEND DOES YOUR MAKEUP | ASMR | Personal Attention | Sassy ASMR | Makeup Application

Hi guys welcome to my ASMR channel! This video was made to help YOU relax and sleep. In this video I do a role-play of being one of Kylie Jenner's best friends. Me and you both live in the hidden hills in Calabasas, CA where Kylie lives. You want me to do

Dhiyanoiseasmr

ASMR URTHBOX UNBOXING VIDEO VEGAN SNACK BOX | Object Tapping, Crinkles, Scratching | Whispering Zzzz

Urthbox (non-affiliate link) just here if you guys wanna try! https://www.urthbox.com *If you are a business/company who would like to contact me about business inquiries...please email me at: jessicachristineasmr@gmail.com ---- Follow me on my social

Dhiyanoiseasmr

Also Maya ASMR

Subs(4770) Views(141048)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Close Whispers & Word Tracing ? (Positive words to make you feel good!) ✨

Hey everyone :3 Tonight we are tracing positive words to brighten your mood and make you feel good! I whisper and trace letter by letter to make you sleepy eheh Hope you enjoy this video! xx _____________________________________ ? My Patreon Family ?

Dhiyanoiseasmr

ASMR to help you with Anxiety | Mic brushing, Close Whispers, Hand movements, Guided Breathing ?

Hi there :3 For today's video I decided to do a very low light environment so we can just relax and be easy on our eyes! Lots of mic brushing, close whispers and some hand movements. I also wanted to help you focus on controlling your breathing and practic

Dhiyanoiseasmr

ASMR | Asking you extremely personal questions! ? (Whispered Roleplay + Keyboard Sounds)

Hi :3 Today I will ask you super personal questions! Keep in mind that these were not targeted at anyone specifically, they are just for the purpose of the video! I've seen some of these videos with questions and I love them so much, so I wanted to do my o

Dhiyanoiseasmr

Catplant ASMR

Subs(398000) Views(81867396)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Whispered Unboxing w/ Close up Triggers (tapping, scratching + other trigger sounds!)

Can you guess the song? Deezer, a global music streaming service, is giving 20 members of the ASMR community a 6 month Premium code (worth $60). That means unlimited access to music and podcasts with zero ads, free downloads and cool features like Flow, a

Dhiyanoiseasmr

ASMR - Lofi Tapping (random rambling trigger sounds - whispered)

I loveee Helix! Thank you for helping me get better sleep. Visit helixsleep.com/catplant to get up to $200 off your Helix mattress, plus two free pillows.

Dhiyanoiseasmr

ASMR - Soft-Spoken Tapping on Objects that I LOVE (vinyl, dvd, plushies, earrings, video game stuff)

Get 20% OFF + Free Shipping @MANSCAPED with promo code CATPLANT20 at MANSCAPED.com! #sponsored #manscaped

Dhiyanoiseasmr

Soft Pause ASMR

Subs(5100) Views(719157)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Dark Audible Face Tapping, Scratching Touching with relaxing Hand Movements | Gentle Whispers

Hey you! Some of your favorite triggers all in one video! Face tracing, face touching, face scratching and gently tapping on your face with sounds! I made the setting quite dark so that you can really relax and drift of to sleep or enjoy the visuals of t

Dhiyanoiseasmr

ASMR | Intense Fabric Cloth Scratching on Different Items | No Talking

Hey you! I chose three different fabric /cloth Items with different materials and texture that I will be scratching and rubbing in this video. They all make very unique sounds and are so relaxing to listen to. No Talking. I hope you enjoy! My Channel: I

Dhiyanoiseasmr

ASMR | Artist does Art on your Face and Hand Movements |whispered, Face Touching, personal attention

Hey you! Second Artist Role Play video! This time creating interesting "Tape-Art" on your face! I made sure to have a dark setting for this video so that it will be relaxing for you and you can just enjoy the hand movements, whispers and trigger words "s

Dhiyanoiseasmr

Love Today ASMR

Subs(52500) Views(16316461)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Facial Treatment (focusing on nose)

Hi friends, In this video I will be giving you a facial (nose) treatment (whispered). I really hope you enjoy it. :) Thank you and remember to LOVE TODAY ASMR Disclaimer: This video is created for relaxation, entertainment and ASMR/tingles/chills ind

Dhiyanoiseasmr

ASMR VACATION (MILLIONAIRE SERIES)

Hi friends, This video is intended to help you imagine being RICH! A millionaire to be exact. Let’s plan your vacation. This video will be soft spoken and it will include typing. I’ll be giving you an overview of your accommodations. I really hope yo

Dhiyanoiseasmr

ASMR Forehead Treatment

Hi friends, In this video I will be giving you a forehead treatment (whispered). I really hope you enjoy it. :) Thank you and remember to LOVE TODAY ASMR Disclaimer: This video is created for relaxation, entertainment and ASMR/tingles/chills inducing

Dhiyanoiseasmr

Caroline ASMR

Subs(621000) Views(135701743)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 17 Earbud Mic Triggers for Brain Melting Tingles and Relaxation (Lofi/No Talking)

? Hi hi! Welcome to a new experimental ASMR video ~ I tried using Apple earbuds as microphones and tested out a variety of sounds like crinkling, tapping, scratching, and some different textures to see how the earbuds would do :3 Thanks to Shawn for edi

Dhiyanoiseasmr

ASMR 8D Clicky Keyboard Typing for Sleep, Study, and Background Noise (No Talking) ⌨️

#ASMR #Typing #NoTalking ?? Welcome to a new typing sound assortment - in 8D! This includes a large print keyboard, 2 different bamboo keyboards, a soft silicone-like key caps keyboard, and a few other clicky keyboards. Which one is your favorite? I

Dhiyanoiseasmr

ASMR Asking You EXTREMELY PERSONAL Questions ?️? (Pen Writing, Whisper, Storm)

Hello there! Welcome to the Question Clinic! ? I would love to know your answers in the comments below, if you’re comfortable sharing any of them ? P.s. Did you catch which question I asked twice? :') P.p.s. It was actually storming when I was reco

Dhiyanoiseasmr

ChinchillaSoft ASMR

Subs(342) Views(15416)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Life Update with My New Dog | Close Up Whispers and Fluffy Mic Brushing ?

Hello! Thanks for watching ChinchillaSoft ASMR. On this channel, I want to help you relax with soft and slow triggers. In this video I am just giving a little close up, whispered update on what I have been up to and why I have not been uploading! I hope yo

Dhiyanoiseasmr

ASMR | Guided Relaxation | Up Close Whispers

Hello! Thanks for watching ChinchillaSoft ASMR. On this channel, I want to help you relax with soft and slow triggers. In this video I want to help you relax and fall asleep with some simple instructions and close up whispers. I hope you enjoy :) I hope t

Dhiyanoiseasmr

LoFi iPhone ASMR | Up Close Personal Attention, Camera Brushing, and Tapping ?

Hello! Thanks for watching ChinchillaSoft ASMR. On this channel, I want to help you relax with soft and slow triggers. In this lofi video I am kind of whispering and softly speaking to you to celebrate reaching 300 subscribers! I hope you enjoy :) Thank y

Dhiyanoiseasmr

Luckily ASMR

Subs(796) Views(46626)

Last Update (07/2021)

Dhiyanoiseasmr

〘ASMR〙 Soft Singing Hit Songs for a Melodic Sleep

A soft singing ASMR video with some of my favorite recent songs from Olivia Rodrigo, Ava Max, Ed Sheeran, Lukas Graham... The singing should be top notch but not loud and definitely good for sleep! 〔 If you like the video consider leaving a like/commen

Dhiyanoiseasmr

Channel Update! - New Videos Coming

An update video where I explain where I'm at right now, the new upload schedule and how free I'll be in the future. Lots of good news in this one guys! 〔 If you like the video consider leaving a like/comment and subscribing for more ASMR! 〕 I won't c

Dhiyanoiseasmr

〘ASMR〙 Whisper-ranking My Favorite "The Walking Dead" Seasons (1-8)

A whispering ASMR video where I talk about my favorite The Walking Dead seasons (that I have watched). *Spoiler Warning for the first 8 seasons* 〔 If you like the video consider leaving a like/comment and subscribing for more ASMR! 〕 I unfortunately

Dhiyanoiseasmr

LifeWordASMR

Subs(6040) Views(493672)

Last Update (07/2021)

Dhiyanoiseasmr

How to respond when you’re caught off guard | Christian Lifestyle | Relaxing Devotion

Have you ever been caught off guard in an uncomfortable situation and weren't sure how to immediately respond? Here is a blanket response to the fiery darts the enemy sends your way to knock you off track in your everyday Christian life. Rela

Dhiyanoiseasmr

Channel update - See you soon!

Quick update - not a drastic change, just some focus on bible study, deep discussion, & relaxing Christian talk. Love & miss you all! Christian ASMR

Dhiyanoiseasmr

CHILL OUT Together & Sleepy Bible Meditation ? Rainy Day Christian ASMR ? Whispers, Thunder, & Taps

Let's chill out together on this rainy spring afternoon and meditate on some scripture passages. 100% authentic full thunderstorm sequence! Whispers, leather tapping, thunder and rain. Perfect to relax or fall asleep while enjoying the company of a Christi

Dhiyanoiseasmr

Sagris ASMR

Subs(1660) Views(151048)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Vietnam| Kí túc xá Sagris| Nói thì thầm

ASMR Sagris ASMR roleplay Vietnamese ASMR Vietnam ThanhASMR Vietnam ASMR Vietnamese Dorm for students Welcome to Sagris Dorm! I am talking about Sagris Dorm with a lot of good facilities such as accommodation, services, library, entertainment, kitche

Dhiyanoiseasmr

ASMR Greek| Day Month and Year| ημέρα μήνα και έτος| Sagris

Sagris ASMR ASMR whispering Asmr whisper ASMR GREEK GREEK ASMR Greece asmr Asmr greece Day, Month and Year Today, I’d like to talk about Day, Month and Year in Greek and how to know which months have 30 or 31 days I hope you like my Greek Thank you

Dhiyanoiseasmr

ASMR Vietnam| Makeup you| Trang Điểm bạn| Lots of Personal Attention | Sagris

Time stamp 00:00 greeting - lời chào 01:07 remove makeup - Tẩy trang 04:38 wipe face - lau mặt 06:07 touch hair - xoã tóc 06:20 brush hair - chải tóc 08:26 hair cut - cắt tóc 10:48 brush face - phủi tóc 12:54 clean face - lau mặt

Dhiyanoiseasmr

TingleFairy ASMR

Subs(478) Views(24898)

Last Update (07/2021)

Dhiyanoiseasmr

*ASMR* Tapping Sounds for Insomnia | NO TALKING

Hi everyone, My upload schedule has been a bit all over the place recently so apologies for that! In this video I share some lovely gifts I received for my birthday and explore different sounds with the items. there is no talking in this birthday asmr hau

Dhiyanoiseasmr

*ASMR* Gentle Rain and SLOW Hand Movements

*ASMR* Gentle Rain and SLOW Hand Movements Hi everyone! In today's video I share some gentle pattering rain sounds which are my absolute favourite sound to listen to! Throughout the video I do super slow hand movements and whisper every now and then. I'm

Dhiyanoiseasmr

*ASMR* My 5 Favourite Sleepy Triggers ?

*ASMR* My 5 Favourite Sleepy Triggers ? Hi everyone! In todays video I share 5 of my favourite sleepy triggers. These include rain sounds, hand movements, mouth sounds, scratching on clothes and rustling hair, and personal attention. I hope you enjoy

Dhiyanoiseasmr

SoftSoundSophie ASMR

Subs(798) Views(66369)

Last Update (07/2021)

Dhiyanoiseasmr

How to say ORANGE in 17 Different Languages | ASMR / Kako se reče ORANŽNA v 17 jezikih | ASMR

?? Hey! Today, we are going to learn how to say Orange in different languages. In this ASMR video, you will hear me whisper orange (oranžna, naranja, narančasta ...) in 17 languages and some candy rummage. I got an idea for this video while eating

Dhiyanoiseasmr

How to say LEAF in 25 Different Languages | ASMR / Kako se reče LIST v 25 jezikih | ASMR

?? Hey! In todays ASMR video, we are going to learn out, how to say LEAF (list, feuille, l'automne, ورقة الشجر, 葉, Blatt, лист, foglia, ...) in 25 different languages. In the video you can hear me whispering word 'leaf' and sounds o

Dhiyanoiseasmr

ASMR | Walking in High Heels | Black Ankle Boots | No Talking / ASMR | Hoja v čevljih z visoko peto

?? Hi! Today I have walking in high heels ASMR video. I am wearing black ankle heel boots and making various ASMR sounds with them on wooden flooring (tapping, heel sound ...). This is no talking video. I hope you will enjoy it. ✅ If you enjoyed

Dhiyanoiseasmr

WithLove L ASMR

Subs(4750) Views(161439)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Gentle Personal Attention ? Up Close Whispers, Hair Brushing, Trigger Words, Touches & Tracing

I have noticed a lot of my requests from my subscribers are personal attention triggers! So I wanted to make a video full of them to help you guys with the most amazing personal attention! I did face touching tracing & poking, Your top fav trigger words, l

Dhiyanoiseasmr

ASMR ⚘ TONS OF TRACING ON YOUR FACE & OBJECTS ☆ Visual Triggers for Sleep

I really love watching other ASMRtists trace on objects and on the camera lens while whispering.. So I wanted to do a video with only tracing triggers! I hope you love tracing ASMR as much as I do friends! I traced on lots of random objects, including your

Dhiyanoiseasmr

Ls Live ASMR ❤ Mixed Triggers For Sleep ?

Hey! I'm so glad you could be here. ??❤ Request some triggers hehe Want to officially become my bestie!? Check out my Patreon! http://Patreon.com/WithLoveL Thank you to my 3 Patrons! I have been working on my Patreon more lately and I have reco

Dhiyanoiseasmr

ZenCatto ASMR

Subs(522) Views(72700)

Last Update (07/2021)

Dhiyanoiseasmr

? ASMR Sea of Thieves - Relaxed Gameplay & Gold Hoarder Voyage (Whisper/Soft Speaking) ?

#GamingASMR #SeaOfThieves #RelaxingGameplay Hey there ? welcome to the 3rd Sea of Thieves ASMR video! If you haven't checked out the first two, take a look (you might enjoy them ?) SOT 1 (chill gaming): https://youtu.be/8dmF-SR63D4 SOT 2 (thunderst

Dhiyanoiseasmr

Sound Bath for Shavasana | 15 Minute Meditation Music | ASMR Singing Bowls Relaxation

#Meditation #ZenCatto #SingingBowls Hello & welcome! Raise your vibration with this video. Sit or lay down and relax for a Shavasana. You can also use this for a 15 minute unguided meditation or general relaxation if you'd like! ? I personally get ASMR

Dhiyanoiseasmr

Crystal Singing Bowl Compilation ? Sound Bath [ Meditation | Sleep Music | ASMR ]

#Meditation #ZenCatto #SingingBowls Crystal Singing Bowls | Himalayan Singing Bowls Here is a crystal singing bowl meditation/relaxation video for your enjoyment! I took some older recordings I had sitting in a folder and combined them into what is (hopefu

Dhiyanoiseasmr

Violet Day

Subs(1950) Views(231254)

Last Update (07/2021)

Dhiyanoiseasmr

[ ASMR n°70 ] Whispered SPA Facial Cleanse Roleplay (W/ Relaxing Music)

LONGER VIDEOS ARE BACK! Hi! Welcome back. In this video, you'll be relaxed and pampered by Amelia. She's the best of the best at the salon, and you wanted to book a much longer appointment with her to feel relaxed. Luckily, she can do just that for you!

Dhiyanoiseasmr

[ ASMR n°69 ] : ~Cozy~ Makeover By Your Older Sister. *Part 1* (Short ASMR)

Today, you'll be visted by your older sister Violet- who you've come to for a quick, and simple makeup look. :D She's (almost always) late for work, so she can spare a few extra minutes to help you get that look you were going for! Enjoy. x (OPEN ME!) ~~~~

Dhiyanoiseasmr

[ ASMR n°68 ] : Casual Whispered Tapping & Rambling (Quick Tingles)

Whoa, she's back again? Indeed I am. :D After two long months, this weirdo is back in action for more *frequent* uploads. I apologize for the delay! Know it's been a bit. Anyway- today would've been a typical 19-20 minute video, but my camera decided to c

Dhiyanoiseasmr

ASMR with Niamh

Subs(604) Views(25298)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Tapping Empty Things

Hiya lovelies!! Todays video is just lots of tapping on lots of empty things and me whispering along, hope you enjoy :)x I post new videos every Tuesday and Friday at 5:30pm (BST) - please subscribe if you would like to see more! Donations are not expect

Dhiyanoiseasmr

ASMR Lofi - Reading You To Sleep #2 (Soft-Spoken)

Hi lovely people!!! Another reading you to sleep video today with a lofi mic and natural lighting and a mixture of whispers and soft speaking, hope you enjoy :) also I love these stories so much, they remind me of my childhood! let me know what your favour

Dhiyanoiseasmr

ASMR - Useless Facts (Lots Of Whispers)

Hi lovely people!! Hope you enjoy me telling you lots of random useless facts in a nice relaxing whisper?x I post new videos every Tuesday and Friday at 5:30pm (BST) - please subscribe if you would like to see more! Donations are not expected but are

Dhiyanoiseasmr

Kaisla ASMR

Subs(4660) Views(315671)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Singing You to Sleep & Triggers (Tapping, Mic Brushing, Kalimba) 30 Minutes ✨ ASMR MUSIC ✨

In this ASMR MUSIC video I'm Singing you to sleep and making music with different Triggers (Tapping, Mic Brushing, "Tk", Soft Spoken, Hand Movements). I'm also playing Kalimba. I'm singing a song that I wrote many years ago! I love Music ASMR and "Sing yo

Dhiyanoiseasmr

ASMR SUOMI | KUISKAILUA ✨ Epätoivon hetkiä ja suuria tunteita ✨ Whispers in Finnish (Lofi)

Tällä ASMR SUOMI -videolla on luvassa pelkkää kuiskailua suomeksi (Lofi), eli en tee muita ääniä. Kerron mun kuulumisia ja puhun mm. epätoivon tunteista (PMS) ja kerron mitä oon tehnyt tällä viikolla, eli arkista höpöttelyä luvassa! Toivottav

Dhiyanoiseasmr

ASMR SUOMI | HÖPÖTTELYÄ & MIKIN SIVELYÄ | Kuiskailua ja kuulumisia✨ Whispering in Finnish & Brushing

Tällä ASMR SUOMI -videolla on luvassa höpöttelyä ja mikin sivelyä! Tällä videolla on pelkästään kuiskailua suomeksi ja mikin sivelyä meikkisiveltimellä. Kerron kuulumisia ja höpöttelen arkisia juttuja, ja kerron myös yhdestä uudesta podcas

Dhiyanoiseasmr

ASMRsense

Subs(36300) Views(1535036)

Last Update (07/2021)

Dhiyanoiseasmr

Astrology ? ASMR ? ALL SIGNS

Hello my fellow tingle astrology lovers ? Today let's see what stars have for us for the month of July. Please comment your sign and like each others' to see how many of each sign we have here! 00:00 Introduction 00:47 Aries ♈ 04:23 Taurus ♉ 08:58

Dhiyanoiseasmr

UNUSUAL TRIGGERS • ASMR • NO TALKING

Hello friends :D Today we'll play with unique sounds and aesthetically pleasing objects that make our brain melt, I hope you enjoy it! 00:00 Preview 05:19 Glitter Pencil Pouch 15:19 Glitter Pencils 28:15 Notebook 36:28 Paper Flower Bouquet 48:32 Sequin R

Dhiyanoiseasmr

Writing in English for YOUR Enjoyment ASMR

Hello friends, I wanted to practice some speaking and writing English letters to share with you today. I hope you will enjoy the sounds and learn along with me! 00:00 Hello 02:40 Notebook 05:15 Pens 06:26 Writing 15:44 Pencils 16:40 Writing 27:10 Markers

Dhiyanoiseasmr

SingStar ASMR

Subs(442) Views(66294)

Last Update (07/2021)

Dhiyanoiseasmr

Eating Corn Cakes and Peanut Butter | Whispering | SingStar ASMR

Crunchy Corn Cake eating ASMR video... Enjoy! SS SUBSCRIBE and Click the BELL to get notified when i have a new video!!

Dhiyanoiseasmr

DOCTOR WHO, SONIC SCREWDRIVER ASMR & WHISPERS and Mic Scratching! Singstar ASMR

SONIC SCREWDRIVER ASMR and whispered chat. Trigger tingles!! Welcome... BIG TINGLES for you!! Maybe to a little soft singing too? SS Twitter @singstarASMR Insta singstar_asmr

Dhiyanoiseasmr

Carpet Scratching | REQUEST VIDEO | NO TALKING | SingStar ASMR

A request ASMR video, Carpet rubbing and Scratching... Enjoy! SS SUBSCRIBE and Click the BELL to get notified when i have a new video!!

Dhiyanoiseasmr

Jookie ASMR

Subs(1710) Views(80597)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Thrift Store Try On Haul ?

Hello! Another try on haul because I like making these ? I went to a few thrift stores and picked up some goodies. Enjoy ?Custom Video: Jookieasmr@gmail.com

Dhiyanoiseasmr

ASMR June Books + TBR ? ?

Happy Pride Month everybody! Today I’m finally back with a book related video. I have a few books to talk about in this video so I hope you enjoy. ? ?Custom Video Inquiries: jookieasmr@gmail.com

Dhiyanoiseasmr

ASMR Doing Your Makeup ?✨ (Personal Attention, Best Friend)

Hello! So I have received quite a number of requests for best friend/friend role plays so I thought I would fulfill those requests with this tingly doing your makeup video. I hope you enjoy ?? ?Custom Video Inquiries: jookieasmr@gmail.com

Dhiyanoiseasmr

Haneul ASMR

Subs(2780) Views(207410)

Last Update (07/2021)

Dhiyanoiseasmr

日本語 ASMR // Painting your Face at a Summer Festival // Soft Spoken Roleplay

Hello everyone, Haneul here! Thank you so much for joining me today, I hope this channel can be a source of peace and comfort for you if you need it. ? In today's video, I will be painting your face at a bright, sunny summer festival! This is the Japane

Dhiyanoiseasmr

한국어 ASMR (eng sub) // Painting your Face at a Summer Festival // Soft Spoken Roleplay

Hello everyone, Haneul here! Thank you so much for joining me today, I hope this channel can be a source of peace and comfort for you if you need it. ? In today's video, I'll be doing your face paint and a fun summer festival. What kind of design would

Dhiyanoiseasmr

日本語 ASMR // Listen to My Voice to Fall Asleep // Repetitive Whispers, Mic Tapping

Hello everyone, Haneul here! Thank you so much for joining me today, I hope this channel can be a source of peace and comfort for you if you need it. ? In today's video, I will be gently tapping on the mic while repeating soothing, relaxing phrases. I h

Dhiyanoiseasmr

ChakraBot

Subs(8000) Views(989179)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR: Fabric massage and whisper

Use headphones. ~~~Enjoy~~~

Dhiyanoiseasmr

ASMR: Dry flowers (crinkling, glass tapping, brushing)

The crinkluing is sort of loud through headphones, so listen through speakers first to judge whether or not you want to use them.

Dhiyanoiseasmr

ASMR: Lush catalogue- Page flipping/soft spoken

I haven't uploaded anything other than readings in too long! Here I am going through a Lush catalogue and talking about my choices, or reading their descriptions. A nice long video for you all.

Dhiyanoiseasmr

ASMRrequests

Subs(497000) Views(139123562)

Last Update (07/2021)

Dhiyanoiseasmr

☀️⛱️ Summertime Self-Care | ASMR | Tapping, Scratching, Soft Speaking, Unboxing

**Disclaimer: I’ve partnered with FabFitFun on this video. This is my impression of the FabFitFun box, and all opinions are my own - and I LOVE IT!!!! ? Use my code [ASMR10] for $10 off: https://fabfitfun.com/welcome/ Hello my friends and fellow Ting

Dhiyanoiseasmr

ASMR - ?? Reading You to Sleep - Soft Speaking, Whisper, Tapping, Page Turning

Good evening and happy Easter and Passover, my friends and fellow Tingleheads! I've been feeling kind of sickly over the last week, so I had to take it easy on shooting - but I wanted to make sure to do at least a LITTLE something for y'all...so here ya go

Dhiyanoiseasmr

ASMR - All Up In Your Ears 3 - Ear cleaning, brushing, cupping, personal attention, & more

Good evening, my friends and fellow Tingleheads! It's been a little while, so I thought it was about time for me to get back UP IN YO EARS!! This is a primarily no talking video, with a teensy bit of whispering thrown in. I hope you enjoy! ❤ For those w

Dhiyanoiseasmr

All Bella ASMR

Subs(28600) Views(3362659)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ✨ Ear Eating, Ear Licking & Ear Noms ?✨

Welcome back to ALL BELLA ASMRrrrr! Hi Everyone! Hope you enjoy this Ear Eating, Ear Licking & Ear Noms video! May it give you some amazing TINGLES! LET ME KNOW WHAT YOU THINK! ?Make sure to LIKE, COMMENT & SUBSCRIBE! Please feel free to comment video

Dhiyanoiseasmr

ASMR ✨ Spanish Whispers & Relaxing Hand Movements

Welcome back to ALL BELLA ASMR! Hi Everyone! Hope you enjoy this Reassuring Spanish Whispers with Relaxing Hand Movement video! May it give you some amazing TINGLES and CALMNESS! LET ME KNOW WHAT YOU THINK! ?Make sure to LIKE, COMMENT & SUBSCRIBE! Plea

Dhiyanoiseasmr

ASMR ✨ Ear Kisses & Mouth Sounds ?✨

Welcome back to ALL BELLA ASMR! Hi Everyone! Hope you enjoy this Ear Kisses & Mouth Sounds video! May it give you some amazing TINGLES! LET ME KNOW WHAT YOU THINK! ?Make sure to LIKE, COMMENT & SUBSCRIBE! Please feel free to comment video ideas! Thank

Dhiyanoiseasmr

FAIRY ASMR

Subs(151000) Views(34837940)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR IL GRANDE RITORNO DI RICHETTA ft. Yes Style || FAIRY ASMR

È tornata Richetta: l'asmrtist perfetta (solo secondo lei). In questo ASMR un po' antipatico e in dialetto romanesco prova a farti rilassare con un unboxing molto speciale in collaborazione con YesStyle. Codice sconto per il sito: YESFAIRY LISTA PRODOTTI:

Dhiyanoiseasmr

ASMR RILASSAMENTO 100% CON LE UNGHIE GIOIELLO! TAPPING DOLCE || FAIRY ASMR

Grazie a Domenico per avermi inviato questo splendido regalo: le unghie gioiello per fare un sacco di tapping rilassante! :) indossa le cuffie e buon ASMR! ✨ NUOVO CANALE DI VLOG: https://www.youtube.com/channel/UCbFqr2AVkEKIc4ZRuUtWfdQ ✨CANALE DI LIV

Dhiyanoiseasmr

ASMR ? PROVO E VI REGALO UN MICROFONO NUOVO! ? ft. FIFINE K690 || FAIRY ASMR

In questo video ASMR provo il nuovo microfono Fifine K690 disponibile a questo link. https://aliexpress.com/item/1005001699081811.html L'azienda che me lo ha inviato ne ha messo a disposizione uno identico al mio da regalare a una persona di voi: scrivi da

Dhiyanoiseasmr

Adrian ASMR

Subs(2380) Views(202275)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Full Body Massage 2!! (Soft Spoken, Personal Attention)

Welcome back everyone!!! This is the highly requested Full Body Massage Part 2! I really hope you all enjoy :) Thank you all for your incredible support! ❤️❤️

Dhiyanoiseasmr

ASMR - My Favorite Albums of 2020! (Whispered)

Welcome back everyone! I hope you all had a fantastic Christmas and New Years! The long awaited Albums video is here :) I hope you all enjoy! Don't forget to relax ??

Dhiyanoiseasmr

ASMR League of Legends Volibear Gameplay! ? (Keyboard, Mouse Sounds)

Welcome back everyone!! I hope your all doing fantastic :) Doing another League video today! The next will be a roleplay I promise :) Hope you all enjoy!! Don't forget to relax ??

Dhiyanoiseasmr

Moonlight Melodies ASMR

Subs(188) Views(8982)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR No Talking, Mouth Sounds, Mic Scratching

Hello and welcome to Moonlight Melodies ASMR. In this video I will be doing no talking, no talking asmr, asmr, mouth sounds, wet mouth sounds, relaxing, mic, mic scratching, windscreen scratching, intense windscreen scratching, intense mic scratching, face

Dhiyanoiseasmr

ASMR My Journal Collection, Whisper, Tracing, Textures

Hello and welcome to Moonlight Melodies ASMR. In this video I will be showing you my journal collection. There are paper sounds, tracing, scratching, sticky, sticky sounds, sticky fingers, light tapping, whisper, whispering, breathy whisper, texture, textu

Dhiyanoiseasmr

ASMR Hair Sounds, Hair brushing, Foam, Whisper

Hi and welcome to Moonlight Melodies ASMR. In todays video I will be doing hair sounds, hair, hair asmr, crunchy, hair brushing, hair brush, brush, tapping, whisper, gentle whisper, breathy whisper, foam, foam sounds, foam asmr, foam in hair, squishy soun

Dhiyanoiseasmr

KiKi ASMR

Subs(2410) Views(244145)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] RELAXING FOOT & LEGS MASSAGE With LOTION? #ASMR #KiKiASMR #footasmr

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary CUSTOM VIDEOS' E-MAIL : chiaranaomi97@live.it

Dhiyanoiseasmr

ASMR | Pure, Wet Mouth Sounds ✨ #mouthsounds #マウスサウンド #KiKiASMR

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary E-MAIL: chiaranaomi97@live.it Hey ciao, sono Kiki ^-^ come avrai notato questo video (no talking)

Dhiyanoiseasmr

ASMR | RAGAZZA TIMIDA ? Shy girl roleplay | 内気な少女ロールプレイ #Whispering #ASMR #KiKiASMR

PATREON: https://www.patreon.com/KiKiASMR?fan_landing=true INSTAGRAM: https://www.instagram.com/kiki_asmr_/ PAYPAL: https://www.paypal.com/myaccount/summary E-MAIL: chiaranaomi97@live.it Ecco qui le mie PLAYLIST: Mouth Sounds/Kissing Sound | マウスサ

Dhiyanoiseasmr

SophiaChristina ASMR

Subs(6590) Views(1181351)

Last Update (07/2021)

Dhiyanoiseasmr

Greek ASMR | Makeup Artist Roleplay

#greekasmr #ελληνικοασμρ Follow me on instagram: @sophiachristinaasmr

Dhiyanoiseasmr

Greek ASMR | Summer Outfits Show & Tell

#greekasmr #ελληνικοασμρ Follow me on Instagram! @sophiachristinaasmr

Dhiyanoiseasmr

HUGE GREEK ASMR COLLAB | Personal attention, whispering, tapping, scratching, and many more...)

#greekasmr Biggest Greek Collab Ever made ! Hope you enjoy ❤️ Don't forget to check Out the channels ❤️ Channel Links: 0:00:00 SophiaChristina ASMR https://www.youtube.com/watch?v=je6ypgw-E4M 0:03:24 Jolly Roger ASMR https://www.youtube.com/wat

Dhiyanoiseasmr

Molgar ASMR

Subs(272) Views(9854)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Morning Affirmations

Dhiyanoiseasmr

baby’s gone we having wine tonight

Dhiyanoiseasmr

it's my birthday lets make some asmr

It's my birthday!

Dhiyanoiseasmr

Dr Bobby ASMR

Subs(3070) Views(63582)

Last Update (07/2021)

Dhiyanoiseasmr

Dr Bobby ASMR: Beard Sounds.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find these beard sounds relaxing. * disclaimer - I thoroughly washed my hands and face prior to, and immediately following, this video, in addition to using alcohol gel! Very

Dhiyanoiseasmr

Dr Bobby ASMR: Multilayered Sounds Compilation.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find this multilayered sounds compilation relaxing. In this video you get four Bobby's for the price of one ... I'm hoping that's a good thing ... ;) This compilation was made

Dhiyanoiseasmr

Dr Bobby ASMR: Negative Energy Plucking.

*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-*-* Welcome (back) to the clinic! I hope you find this negative energy plucking relaxing. I think we all deserve to connect with a sense of peace during these difficult times! :) Ps. You're all amazing. Stay safe. x *-*

Dhiyanoiseasmr

Whisperwind ASMR

Subs(7250) Views(583685)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | The Peddler Helps You on Your Quest | Into the Forest, Part I

Zot the peddler has returned, so you approach her to return the valuable crest you borrowed from her previously. What else might she have to offer you today? This video is the beginning of a new adventure! Subscribe to catch the whole story! New to the

Dhiyanoiseasmr

ASMR Black Widow Gives You a Checkup | Checking You for a Concussion

You've been recruited as a new initiate into the Avengers! You've been put through rigorous training to determine your skills, and you took a hit in an exercise earlier today. Black Widow is here to look you over and make sure you're okay! ASMR check up,

Dhiyanoiseasmr

ASMR Vampire Interviews You For Her Faction | Ronnie the Protector

So you wanna be a vampire, huh? Well, thanks to the Institute, qualified candidates can go through an extensive screening process to make all your undead dreams come true! You've jumped through all the hoops, and there's only one thing left to do: you need

Dhiyanoiseasmr

Tyson ASMR

Subs(65900) Views(7239848)

Last Update (07/2021)

Dhiyanoiseasmr

How To Give Yourself Intense ASMR Tingles (Part 6) - Self Induced ASMR Sensations - Sleep Inducing

How to get intense asmr tingles using an ancient technique ? Join this channel to get access to perks: https://www.youtube.com/channel/UCK2ZIpAgJhHRH5Ex2j3Nw-A/join Tip Jar: paypal.me/tysonhamblin Don't forget to like and subscribe and hit the bell!

Dhiyanoiseasmr

ASMR New Tattoo Tour | Realism Sleeve Tattoo | Meaning, Pricing, Pain

I finally got more work done on my sleeve after a year and a half! I absolutely love it :) I will go into the meaning, pricing, story behind each piece, and the pain. Join this channel to get access to perks: https://www.youtube.com/channel/UCK2ZIpAgJhHRH

Dhiyanoiseasmr

ASMR Asking You Insanely Personal Questions (Uncomfy) - Writing Sounds - ASMR Roleplay

asking you extremely personal questions Asmr Roleplay Join this channel to get access to perks: https://www.youtube.com/channel/UCK2ZIpAgJhHRH5Ex2j3Nw-A/join Tip Jar: paypal.me/tysonhamblin Don't forget to like and subscribe and hit the bell! Support m

Dhiyanoiseasmr

Ivča ASMR

Subs(6890) Views(2188447)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR šeptání, vybarvování/ASMR whispering, coloring

Ahoj, vítejte u dalšího videa, které bude na pokrčování :) Hi, welcome to the new video, which to be continued :)

Dhiyanoiseasmr

ASMR pohyby rukou, latexové rukavice/ASMR hand movements, latex glove

Ahoj, zdravím vás :) Mám pro vás další video :) v některých místech může blbnout zvuk, za to se omlouvám, poslouchejte napoprvé raději tišeji :) Užijte si to!

Dhiyanoiseasmr

ASMR listování časopisem, šeptání/ASMR flipping trough the magazine, whispering

Dhiyanoiseasmr

Lizzylizz ASMR

Subs(1910) Views(133219)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Español|COMIENDO NIK-L -NIPS WAX BOTTLE CANDY| MOUTH SOUNDS

HOLA TODOS!!! Bienvenidos a otro video en Español, hoy voy a estar comiendo los dulces #niklnips Espero que les guste el video!!

Dhiyanoiseasmr

ASMR| update

Hello everybody! This is really just an update video, I wanted to let you guys know that I havent forgotten about you guys I really just had something big happening in my life so unfortunately I was unable to post videos?? I have missed you guys so

Dhiyanoiseasmr

ASMR| Whisper Ramble

Hello everybody ! Welcome back to another video! I know I’ve been gone for a little while so I hope you guys enjoy this quick #whisper #ramble I filmed for you guys. Thank you so much for watching! ♥️♥️

Dhiyanoiseasmr

Prim ASMR

Subs(173000) Views(32359373)

Last Update (07/2021)

Dhiyanoiseasmr

Nintendo Switch Animal Crossing Special Edition Unboxing ASMR

Dhiyanoiseasmr

Close Up Personal Attention ASMR Gentle Hand Movements • SK SK SK • Inaudible Whispers in Your Ears

I hope you enjoy this. ♥️ My second channel: https://www.youtube.com/channel/UCeluW_wlg6bPHaTDI2I2aJA What does ASMR stand for? Autonomous Sensory Meridian Response What IS ASMR? A feeling of well-being combined with a tingling sensation in the sc

Dhiyanoiseasmr

Asking you Random Questions • ASMR Typing Sounds • Click Click •

I hope you enjoy this. ♥️ My second channel: https://www.youtube.com/channel/UCeluW_wlg6bPHaTDI2I2aJA What does ASMR stand for? Autonomous Sensory Meridian Response What IS ASMR? A feeling of well-being combined with a tingling sensation in the sc

Dhiyanoiseasmr

Sonagi ASMR

Subs(21900) Views(1516563)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Brushing Hair & Whispering | about hair cut, some accident, tapping... (English sub)

In this video, you can hear whispering sounds while brushing my hair. Hope you enjoy ? If you'd like to support my channel : https://www.buymeacoffee.com/sonagiasmr ------------------------------------------------------------- ?Playlist ▶Sonagi'

Dhiyanoiseasmr

ASMR Ear Blowing & Layered Mic Rubbing Sound | Fluffy Windshield | Mic Touching | 1Hr (No Talking)

In this video, you can hear the sound of ear blowing and rubbing the mic at the same time. The mic rubbing sound is layered sound. Hope you enjoy ? If you'd like to support my channel : https://www.buymeacoffee.com/sonagiasmr -------------------------

Dhiyanoiseasmr

ASMR Mic Nibbling | Brain Melting Mic Eating | Intense Brain Eating | Kissing Sounds | Mouth Sounds

The sound of this video is very intense sounds, not soft sound like the "Ear Blowing ASMR" that I've uploaded a lot so far. Please adjust the volume ! And hope you enjoy ? If you'd like to support my channel : https://www.buymeacoffee.com/sonagiasmr

Dhiyanoiseasmr

Sweet Nothings ASMR

Subs(378) Views(15583)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Travel Agent Books Your Next Destination ~ Soft Spoken ~ Typing Sounds || Italy Edition ||

Hey guys! I hope everyones had/having a wonderful day! :) For todays video I'm going to be booking your holiday to magnificent Italy :) For the majority of us at the moment we aren't able to travel so I thought it would nice to dream a little. Italy is a c

Dhiyanoiseasmr

[ASMR] My Golden Box of Relaxing Tingly Sounds

Hello Loves! I really hope you enjoy my new video! :) 00:00 Golden Box Intro 02:25 Glass Jar of Styrofoam Balls 07:56 Shells in Mesh Bag 11:29 Angel Hair (or fairy floss ;P) 15:29 Sea Glass 18:33 Bag of Diamonds 22:31 Slime 27:10 Page Flipping 31:16 Silver

Dhiyanoiseasmr

[ASMR] Personal Attention off an Elvish Princess ~ Soft Spoken

Hello loves! I'm a huge fan of LOTR and and I've always wanted to dress up as an elf so here we are :) It's a lil' blurry at the beginning I'm sorry but it does sort it's self out. So sit back, relax and hopefully enjoy :) Lots of Love! x ***If you enjoye

Dhiyanoiseasmr

ASMR Ear Love

Subs(5560) Views(1682174)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 100% TINGLES (I BET)

Now you can order a video For the Donate - https://www.donationalerts.com/r/asmrearlove Please click 'Like' and comment! This will help promote the video and I will be very pleased! ASMR Community - https://vk.com/asmr_tapping ASMR moans #asmr

Dhiyanoiseasmr

ASMR OIL MASSAGE

Subscribe for MORE! https://vk.com/asmr_tapping

Dhiyanoiseasmr

ASMR lISTEN TO MY HEART (asmr mouth sounds)

ASMR lISTEN TO MY HEART (asmr mouth sounds) https://vk.com/asmr_tapping

Dhiyanoiseasmr

Bee Silence ASMR

Subs(1760) Views(98319)

Last Update (07/2021)

Dhiyanoiseasmr

*WARNING*: INTENSE RELAXTION | SLEEP CLINIC ~ ASMR

asmr intense relaxtion - sleep clinic Hey everyone! Todays video includes very relaxing sounds to help you unwind. Enjoy #BeeSilenceASMR #ASMR #SleepClinic #AsmrSleep ---------------------- ??????? ?? ----------------------

Dhiyanoiseasmr

ASMR Triggers To Help YOU Fall Asleep ?

|?? ?????? ???????? ?? ?-? ?????? ?? ? ???? ?? ????? ???? ????????? ??? ????

Dhiyanoiseasmr

ASMR | Soft and Gentle Mic Brushing (No Talking)

|?? ?????? ???????? ?? ?-? ?????? ?? ? ???? ?? ????? ???? ????????? ??? ????

Dhiyanoiseasmr

ASMR Around The Universe

Subs(362) Views(18583)

Last Update (07/2021)

Dhiyanoiseasmr

ASMRtist Reacts to Tiktok / Instagram ASMR

Triggers in this video: whispering, entertainment! xD PS thumbnail and video inspired by ASMR Winkeyy ____ Thanks for watching! I post on Tuesdays and Saturdays, see you soon!! ___ My equipment: Mic - Blue Yeti Nano Camera - iPhone 11 ___ Socials: Instagra

Dhiyanoiseasmr

ASMR 1 Minute Doctor Checkup Roleplay (fast)(tingly)

Enjoy! Triggers in this video: whispering, writing, visual triggers, follow the light, mouth sounds, hand sounds, tapping ____ Thanks for watching! I post on Tuesdays and Saturdays, see you soon!! ___ My equipment: Mic - Blue Yeti Nano Camera - iPhone 11

Dhiyanoiseasmr

ASMR Except I Am Glass, Wood, Plastic, Etc (TAPPING GALORE) [inspired by Eevy ASMR]

Ready for a tsunami of tingles? This ASMR video will surely have that effect! Triggers in this video: Tapping on glass, plastic, wood, and other items; scratching; whispering ___ Thanks for watching! I post on Tuesdays and Saturdays, see you soon!! ___ My

Dhiyanoiseasmr

ASMRWithOllie

Subs(13200) Views(1658529)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] COVID-19 Test Roleplay | Medical Doctor Coronavirus | Soft Spoken Personal Attention & Gloves

Hello! It's been a fair while since my last upload - the whole audiobook debacle sent me into a bit of a tailspin and I feel like the first part of this video wasn't as "ASMR-esque" as I would have liked but when it gets into the testing part I'm quite hap

Dhiyanoiseasmr

[ASMR] Wrapping Christmas Presents With Your Boyfriend Roleplay

Hello! This was... a long video to edit - I was in two minds about actually uploading it if I'm honest, mostly due to the echo but I felt like the wrapping sounds were super loud too. In the end, I decided I'd leave the decision up to you! If you don't fin

Dhiyanoiseasmr

[ASMR] Ramble With A Tiny $1 Microphone

Hello! Check out the Santa Christmas Subway Run game on IOS (and Google Play soon). There's a link below as well - this video is a bit of nonsense but I hope you enjoy it! The triggers in this video are literally just soft speaking, some whispering and a

Dhiyanoiseasmr

Little Clover Whispers

Subs(108000) Views(10734259)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | The Sun is the Enemy - How to Protect Against your Biggest Foe ☀️

During today's video I talk a bit about my new sunburn (yes, I wore sunscreen.. I'm a pale boi, okay??) and how YOU CAN PROTECT YOURSELF AGAINST THE SUN! Step one... Stay inside! I hope you find this video as tingly as my skin is feeling right now! Excus

Dhiyanoiseasmr

ASMR | Spending Time with your Girlfriend at the Beach ?? Satisfying Roleplay

Wake up sweetie.. You fell asleep on the sandy shore! It's super hot outside and your girlfriend wants to spend some quality time with you! This video features popsicle nomming, soft noises of the waves hitting the beach, sunscreen application and sand rem

Dhiyanoiseasmr

ASMR | Model Goes Live and Answers Sweet Messages ?

I hope you enjoy this roleplay of a model going live on one of her special platforms and chatting with her fans while answering her emails and comments! I chat with people online for hours every day and it was fun to give you a bit of an insight as to what

Dhiyanoiseasmr

ASMR DOLL

Subs(145000) Views(23292353)

Last Update (07/2021)

Dhiyanoiseasmr

ZAFUL Summer/Beach Inspired TRY ON HAUL (Close-Up Whispering, Inaudible Mouth/Fabric Sounds)

ONLYFANS: https://onlyfans.com/onlysaba Shop ZAFUL’s 7th Year Anniversary Sale: http://fshion.me/302DWKY USE DISCOUNT CODE “DOLL18” FOR 18% OFF YOUR NEXT PURCHASE ♡ Criss Cross Wrap Crop Top (one size): http://fshion.me/302EljB ♡ Solid Color

Dhiyanoiseasmr

ASMR | Hair brushing / Styling & Life Update! (Tapping, Hand Movements, Rambling)

ONLYFANS: https://onlyfans.com/onlysaba Duvolle® 70% OFF PROMO CODE: ASMRDOLL70 Duvolle® Desire Series Styling Iron: $28.50 https://duvolle.com/desire-series-styling-iron/ ? INSTAGRAM: https://bit.ly/3kTsZmo ? BUSINESS INQUIRIES: asmrsaba@gmail.co

Dhiyanoiseasmr

ASMR | Sneakers Collection (Softly Spoken / Whispered)

☁️ My Patreon is paused for the next few months while I finish school. Working full time and studying is not easy, so thank you for being patient with me! I hope you're healthy and well, dolls. Xo ? INSTAGRAM: https://bit.ly/3kTsZmo ? BUSINESS I

Dhiyanoiseasmr

WhispEatingBabe ASMR

Subs(21600) Views(5096132)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR (Doing My Makeup) Chewing Gum No Talking

Hey my beautiful people! Im Jackie (WhispEating Babe) Welcome! To THE BEST ASMR!...Relaxation, Enjoyment & fall asleep!! ASMR (Doing My Makeup) Chewing Gum No Talking Show me that ASMR LOVE!! Like, Comment and SUBSCRIBE! Turn the bell on to be notifie

Dhiyanoiseasmr

ASMR MUKBANG (Eating Korean) Bibimbap* Mixed Rice With Meat And Assorted Vegetables

Hey my beautiful people! Im Jackie (WhispEating Babe) Welcome! To THE BEST ASMR!...Relaxation, Enjoyment & fall asleep!! ASMR MUKBANG (Eating Korean) Bibimbap* Mixed Rice With Meat And Assorted Vegetables Hey beautiful people! Hope you are staying heal

Dhiyanoiseasmr

ASMR (Doing My Makeup) Soft Whisper / Chewing Bubble Gum

Hey my beautiful people! Im Jackie (WhispEating Babe) Welcome! To THE BEST ASMR!...Relaxation, Enjoyment & fall asleep!! ASMR (Doing My Makeup Tutorial) Chewing Bubble Gum Hello my beautiful, hope you all are staying safe & healthy! Today's video I am

Dhiyanoiseasmr

ocalymaASMR

Subs(7270) Views(1014582)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Soft-Spoken/Whisper Rambling, Brushing (Test Video)

I'm trying to ease my way back into contributing to the ASMR community! Apologies for the unrefined editing (still getting used to a new program). #nervous

Dhiyanoiseasmr

3D ASMR ~ Gentle Tapping and Tracing the Microphone

***HEADPHONES HIGHLY RECOMMENDED*** Hey hey! It's been awhile, I know. I mentioned it on my Facebook, but my uploads will be slowing down while I'm in school. But don't think I've forgotten about you! This is a shorter than normal video. My dog was real

Dhiyanoiseasmr

~ASMR~ Soft-Spoken Organic Chemistry Tutor Role Play

Hola! This is a tutoring role play for you guys. Just FYI, I didn't fact check anything I said in this video, I just did it all from memory. So just to be safe, don't use this as an educational resource. It's only meant for relaxation. There is a small s

Dhiyanoiseasmr

Mr.Manly ASMR

Subs(239) Views(26380)

Last Update (07/2021)

Dhiyanoiseasmr

Babysitting The Child

Your Mandalorian neighbor has dropped off his "child" for you to babysit for the evening, but you're not really prepared for such a task. Trying to record more videos but I live in the city in a bit of a noisy neighborhood so it can be a little frustrati

Dhiyanoiseasmr

Let's Play No Man's Sky ASMR

Travel the galaxy with me as I play through some of No Man's Sky while whispering commentary. I'm relatively new to the game and it shows, but I'm enjoying it immensely. Please like or subscribe if you dig the video. Also feel free to comment with any cr

Dhiyanoiseasmr

Dragon Ball Kame House: ASMR Guided Meditation (whispers, beach sounds)

Time for a trip to a favorite beachside retreat. This video will help you to relax, fall asleep, and balance your qi. Listen along and enjoy. Also if you enjoy my content please like the video and subscribe to my channel. More good stuff to come. Sleep w

Dhiyanoiseasmr

bluezzz ASMR

Subs(4900) Views(544920)

Last Update (07/2021)

Dhiyanoiseasmr

Welcome To The Coven (Witch ASMR, Soft Spoken, Singing)

This video is my part for the collaboration put together by the amazing CalmingEscape ASMR. Please go give her a sub - links to her channel and the collab video will be right under. This is a soft spoken video with hand movements, singing and some bubbling

Dhiyanoiseasmr

ASMR Eye Exam - Light Test, Eye Chart, Follow Finger (Soft Spoken)

Hey guys! Hope you are having a great weekend. I'm sorry I'm not uploading as regularly as I used to but... life. This video includes triggers like light triggers, visual triggers, soft spoken, whispers, eye chart, glass dropper, follow the finger... Hope

Dhiyanoiseasmr

ASMR Unboxing Dolls Kill Shoes - Black Combat Boots

Hey guys! In tonight’s video, I’m gonna unbox my favourite pair of shoes - super chunky Dolls Kill Dark Dominion boots. Its a casual chatty video with some tapping, crinkles and scratching. Soft spoken. Sorry for being awkward, I haven’t filmed for a

Dhiyanoiseasmr

ASMR Elii

Subs(956) Views(20710)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR invisible trigger tingles #shorts

Dhiyanoiseasmr

ASMR FABRiC SCRATCHiNG & TAPPiNG ????? FAST clothes sounds

#asmr #asmrfabricscratching #fabricscratching #asmrtingles #tingles #asmrsounds #asmrtrigger #trigger ✨✨ GOOD VIBES ONLY ✨✨ ~ Hiiii Whispi, today it's fabric scratching. Enjoy, relax and sit back ?✨✨✨❣️ ~ Muuuuuch l?ve Elii

Dhiyanoiseasmr

ASMR tingly trigger #shorts

Dhiyanoiseasmr

Basic ASMR

Subs(737) Views(30887)

Last Update (07/2021)

Dhiyanoiseasmr

(For My Subscribers) Quick Channel Update - Talking and Whispering

Hi Guys, sorry I've been away for a while, I explain all in the video, I will be back soon though, just need to get used to the work and study life, then Ill have enough time to make quality content. In case you wonder, I recently had a shower and I mois

Dhiyanoiseasmr

Best/First ASMR Lego Sounds x 4 - Intense Tingles Guaranteed.

Welcome to my ASMR Lego Sounds x 4, Intense Tingles Guaranteed. there is a bit of chatter at the beginning followed by blissful Lego sounds, if you're not into Lego, its worth a try, and if you are into Lego sounds, then you're in for a treat. Enjoy.

Dhiyanoiseasmr

ASMR - Sorting then Counting Quality Street Chocolates - Methodical ASMR

Ever wondered how many chocolates are in a tin of Quality Street, or how many of each type? Today on Basic ASMR we will be sorting and counting a whole tin of 'Quality Street - Christmas 2019 Edition'. If you're not familiar with ASMR and just enjoy sort

Dhiyanoiseasmr

Afox ASMR

Subs(12200) Views(1369352)

Last Update (07/2021)

Dhiyanoiseasmr

[日本語 ASMR] Whispering Japanese Trigger Words To Help You Sleep | 言葉繰り返し

Hi! this is my first ever Japanese video and I'm very nervous about sharing my speaking Japanese with you guys.. I know I made a few mistakes in pronouncing some words but I will get better! Triggers: 1 カタ 2 友達 3 ニコ 4 ステキ 5 ドキ?

Dhiyanoiseasmr

[ASMR] Little Q&A Part 2! | Soft Spoken

Thanks for everyone's patience in part 2 ^.^ I have been a little busy so took me a while to find time to edit this part. I will be recording some new roleplays REAL soon which I'm happy about! sleep well xoxox

Dhiyanoiseasmr

[ASMR] Little Q&A! Part 1 | Soft Spoken

I finally got round to doing a q&a which turned out to be rather long so I've split it into two videos. I hope you enjoy and maybe get to know me a little better xox

Dhiyanoiseasmr

Snowy ASMR

Subs(24100) Views(2358657)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Lets Nap Together ~ Personal Attention ?

Hope you enjoy!! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please note this is 18+ only) ?Patreon - https://www.patreon.com/snowylowther ?Twitter - @xsnowy ?Tiktok - @snowysioux ?Tips - https://www.paypal.com/

Dhiyanoiseasmr

DEEP Ear Picking ASMR - Ear Cleaning Roleplay

This was highly requested! A Ear Cleaning of JUST the Picking tool! Its my favourite sound too and I loooove this trigger in ASMR :) Hope you enjoy!! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please note this is 18+ only)

Dhiyanoiseasmr

Classic Eye Examination ASMR Roleplay

A classic eye examination with glove sounds, follow the light, snellen reading chart, field of vision test, eye drops and person attention with soft spoken/whispering...Enjoy! ?Instagram - @xsnowy ?Only Fans - https://www.onlyfans.com/xsnowy (Please

Dhiyanoiseasmr

Orenda ASMR

Subs(160000) Views(19949624)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] French Maid Gives You the Most Personal Attention You've Ever Had (Role Play)

Social media: There's a much better version of this video on my 0nlyfans:@orenda https://www.instagram.com/theorenda_ https://www.twitter.com/orendasfs https://www.facebook.com/orendaasmr If you are not interested in my Only Fans page but want to su

Dhiyanoiseasmr

[ASMR] LOVE IS THAT TINGLE French Girlfriend Role Play Whispering Sweet Nothings

Social media: There's an extended version of this video on my 0nlyfans:@orenda https://www.instagram.com/theorenda_ https://www.twitter.com/orendasfs https://www.facebook.com/orendaasmr If you are not interested in my Only Fans page but want to supp

Dhiyanoiseasmr

[ASMR] Breathy Kisses ? & Brain Massage (Mic Scratching)

Social media: Find an extended version of this video on my 0nlyfans:@orenda https://www.instagram.com/theorenda_ https://www.twitter.com/orendasfs https://www.facebook.com/orendaasmr If you are not interested in my Only Fans page but want to support

Dhiyanoiseasmr

ASMR COSMONAUT

Subs(10000) Views(1595693)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ICNBUYS Zen garden & Unboxing and Relaxing Playing with Zen Garden (No Talking)

Purchased Zen Garden Products from: https://www.amazon.com/dp/B01II9PHI4 PLEASE, USE THE HEADPHONES! 00:00 - 01:28 - Introduction (Whisper ENG) 01:29 - 18:42 - Unboxing with tapping, scratching, rubbing, rustling and items showing 18:43 - 41:50 - Zen G

Dhiyanoiseasmr

ASMR #2 Russian Language Lesson From Native Speaker & Numbers for the Beginners

PLEASE, USE THE HEADPHONES! The second ASMR Russian Lesson is dedicated to numbers and their endings. So, it is a lesson for the beginners and you can skip this part, if this theme is well-known to you :) -------------------------------------------------

Dhiyanoiseasmr

ASMR Cluedo Tracing & Inaudible Close Up Whispering & Mouth Sounds (Inaudible Whisper)

PLEASE, USE THE HEADPHONES! Tracing became one of my favorites triggers not a long time ago. Also I wanted to try inaudible whispering. I decide to combine these triggers in this video. Let me know what do you think about it :) --------------------------

Dhiyanoiseasmr

Zephyr Whispers ASMR

Subs(1970) Views(47739)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Coding at Work

Hi everyone ? join me as I work at my desk for some nice keyboard sounds and ambience - I am actually at work so probably won't be able to respond to messages but I'll leave live chat on!

Dhiyanoiseasmr

ASMR - Working at my Computer as a Coder | ASMR Typing Sounds

Hi everyone ? join me as I work at my desk for some nice keyboard sounds and ambience - I am actually at work so probably won't be able to respond to messages but I'll leave live chat on!

Dhiyanoiseasmr

ASMR - Working Live! | ASMR Typing Sounds

Hi everyone ? join me as I work at my desk for some nice keyboard sounds and ambience - I am actually at work so probably won't be able to respond to messages but I'll leave live chat on!

Dhiyanoiseasmr

Whispers of the Wolf ASMR

Subs(33700) Views(1951594)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR REIKI plucking & scooping anxious thoughts | hand movements, negative energy removal | healing

ASMR REIKI plucking & scooping your anxiety | hand movements, negative energy removal | energy healing and chakra balancing 00:00 intro 01:41 intention setting with candle 02:46 sage smoke cleanse 07:51 reiki symbols 09:49 cleansing sweeps 10:55 scooping

Dhiyanoiseasmr

ASMR REIKI manifest love while you sleep ?chakra balancing, binaural beats, hand movements, whisper

ASMR REIKI attract and manifest love while you sleep ? heart chakra healing, binaural beats 7.83 Hz, guided visualisation, hand movements, energy healing & activation, whispered chakra balancing, finger flutters 00:00 intro 03:16 incense smoke cleanse

Dhiyanoiseasmr

ASMR REIKI drawing & tracing reiki symbols on chakras for sleep | hand movements, balancing chakras

ASMR REIKI drawing & tracing reiki symbols on your chakras for sleep | hand movements, chakra balancing & healing energy 00:00 intro 01:11 introducing the reiki symbols 02:16 cho ku rei 04:11 sei he ki 06:39 hon sha ze sho nen 09:31 reiki symbol sandwich

Dhiyanoiseasmr

asmrvilla

Subs(97100) Views(37919245)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR * Up Close Arm & Back Scratching * Pampering my Friend :) * No Talking * ASMRVilla

Hi Everyone! In this video I will be whispering and helping my friend fall asleep as I scratch her back, arms and head :) No Talking Version: https://www.youtube.com/watch?v=mdGmEpu2CEs Instagram: https://www.instagram.com/asmrvillafam/ My ASMR Merch

Dhiyanoiseasmr

ASMR * Tapping through my Gym/Dance Studio * Fast Tapping & Scratching * Soft Spoken * ASMRVilla

Hey Everyone!!! I will be Tapping & Scratching through my Dance Studio and side rooms with Gym Equipment while Softly Speaking with you in this video :) Thank you so much for watching!! No Talking Version: https://www.youtube.com/watch?v=H-I33J3SbNE ?

Dhiyanoiseasmr

ASMR #Shorts * Puffy and Scratchy "Boxes?" * ASMRVilla

Hi Everyone! I wanted to try putting up a Youtube Short for you. Once in a while I film little ASMR clips when I am out and about for you so this will be a perfect place to put them. A quick little tingle in the middle of your day hehe ;) PS Not all con

Dhiyanoiseasmr

Tishe ASMR

Subs(1510) Views(76142)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - RELAXING NAIL TAPPING SOUNDS (FAST&SLOW)

HI guys! You will see ASMR NAIL TAPPING video and I hope you will like it ❤️PLEASE WATCH TILL THE END❤️ Please support me with your likes and comments! Subscribe to see more videos and don't forget to turn on the notifications. WATCH MY OTHER

Dhiyanoiseasmr

ASMR - BODY SCRATCHING SOUNDS RELAXING FULL OF TINGLES FOR YOUR SLEEP

HI guys! This is longer version of body scratching video so I hope you will like it more than short one) ❤️PLEASE WATCH TILL THE END❤️ There will be RELAXING TINGLY BODY&CLOTHES SCRATCHING SOUNDS FOR YOUR SLEEP. I LOVE THIS SOUNDS SO MUCH! Hope

Dhiyanoiseasmr

ASMR - CLOSE UP. 5 MIN AND YOU WILL FALL ASLEEP. BODY SCRATCHING

HI guys! This is my first short ASMR video with body scratching sounds. I want to test this type of video so will see if you like it or not)) ❤️PLEASE WATCH TIL THE END❤️ There will be CLOSE UP and TINGLY BODY&CLOTHES SCRATCHING SOUNDS. I hope

Dhiyanoiseasmr

Scooperdoodle ASMR

Subs(7250) Views(670669)

Last Update (07/2021)

Dhiyanoiseasmr

Kitten Purring ASMR (old school)

Please enjoy the soothing sounds of my cat, Brie, purring

Dhiyanoiseasmr

Old School ASMR Antique Hand Crank Sewing Machine *No Talking* Scooperdoodle ASMR

Hello friends! This video is purely selfish, because I wanted it :) Here is an extended, sewing-only video with my antique 1930’s Hand Crank Singer 99k sewing machine! (I really love this thing)

Dhiyanoiseasmr

Old School ASMR Vintage Hand Crank Sewing Machine Test *No Talking* Scooperdoodle ASMR

Hello all, long time no see! I figured I’d kick off my return with an old school cellphone ASMR video. I don’t have a laptop anymore, so unfortunately this will have to do. In this video I’m making a scrunchie (minus the finishing touches) out of s

Dhiyanoiseasmr

Mixed ASMR

Subs(55600) Views(9037173)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Good morning! Breakfast time!

Dhiyanoiseasmr

ASMR Stream- This time YOU tuck ME in

Dhiyanoiseasmr

ASMR I am very small and I have no money

Dhiyanoiseasmr

ASMRtherapy

Subs(3580) Views(752082)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Reporting a Crime to the Police ● Soft Spoken Roleplay

ASMR Roleplay where you are at the local police station reporting that your apartment has been burglarized. I (a police officer working there) will assess the situation and make a report to help you retrieve your items. Everything is soft-spoken and made s

Dhiyanoiseasmr

[ASMR] Dream Job Interview ● Soft Spoken Roleplay

I got an offer you can't refuse... but for this, you will need to take part in this job interview. It's not a usual one by any means.. but again the job itself is quite unusual as well. Hope you enjoy this little ASMR roleplay :) ► Please subscribe if y

Dhiyanoiseasmr

ASMR Robot Check Up & Repair - Roleplay - Relaxing Whisper and Triggers

Anual space robot check-up and repairs roleplay. Whispering and using various different trigers. Whispering roleplay made for relaxation and falling asleep faster. ► Please subscribe if you want some more ► ASMR Therapy Album Vol.1 on Bandcamp (fr

Dhiyanoiseasmr

ASMR Only

Subs(2380) Views(118717)

Last Update (07/2021)

Dhiyanoiseasmr

*ASMR* DEEP & INTENSE Experimental Triggers to make you TINGLE & SLEEP ? (NO TALKING)

Who doesn't like some ASMR Deep and Unique Experimental triggers.? In today's video, i have some unique and experimental triggers to make you tingle down your spine. Some of these triggers include intense tapping, scratching, vigorous sounds. While there a

Dhiyanoiseasmr

*ASMR* EXTREME SPICY FIRE NOODLES (No Talking) EATING SOUNDS

ASMR EXTREME SPICY FIRE NOODLES (No Talking) EATING SOUNDS. i sweat a lot. lol ***If you do not enjoy EATING SOUNDS, DO NOT WATCH. *** What is ASMR? Autonomous Sensory Meridian Response is an experience characterized by a static-like or tingling sensati

Dhiyanoiseasmr

Asmr - Mouth Sounds gone SXXUAL ? (Mic Nibbling/ licking, Kissing, Deep breathing Sounds)

Asmr intense Mouth Sounds gone Sexual. Get ready to cringe while relaxing at the same time haha. Previously: Asmr for people who don't get Tingles https://goo.gl/mgJrnG #Asmr #MouthSounds #intense

Dhiyanoiseasmr

Reiki Kisses ASMR

Subs(420) Views(32287)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR #shorts Pick a Fairy Card ??‍♀️

Dhiyanoiseasmr

ASMR ? Match Lighting ? Whispers ?

Hi Lovies ? Here is a requested match lighting video ?? Just to warn you * there are lots of background sounds * ? Wishing for your dreams to be lit up like a flame ;) ? & wrapped around you with warmth and love ? Love and huggles to

Dhiyanoiseasmr

ASMR✨ Follow the chain ?⛓| Soft Spoken | Writing Sounds ?

Hi Sweetest Souls ? I don’t really know what I’m doing in this little video ??‍♀️⛓? but thanks for helping me out ? & hope you find it soothing :p?? Love you always x o x ? Email me at ➡️ ? reikikisses@gmail.

Dhiyanoiseasmr

Gentle Whispering ASMR

Subs(2090000) Views(900308597)

Last Update (07/2021)

Dhiyanoiseasmr

Color Analysis ? ASMR ? Soft Spokenish

Hello friends :) today we'll be taking a closer look at what colors suit my dear husband Darryl best. I hope you enjoy this different type of a video from this channel ♥ Color analysis is a tool designed to help us figure out the colors that are synergy

Dhiyanoiseasmr

Things that Spark Joy ○ ASMR ○ Soft Spoken ○ Chit Chat

Hello :) How have you been? What's new in your world? I've been a bit more exhausted and unsettled lately (said every stay at home parent, lol) BUT also very grateful for my life and today we'll do a chit chat, deal? :D 00:00 why no cool videos, Maria? 02

Dhiyanoiseasmr

Fancy Fabrics ○ ASMR

Welcome to my Fabric Shop, let me show you some of our most amazing materials ♥ 00:00 Preview 3 min long :) 03:18 Welcome 04:02 White flower tulle 10:51 Large layered sequins 16:28 Lint rolling 18:44 Blue velvet with golden applique 26:07 Orange iridesc

Dhiyanoiseasmr

MH ASMR

Subs(2520) Views(87463)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Camera tapping on my iPhone | LoFi

Dhiyanoiseasmr

ASMR | True Crime: Shanda Sharer

Dhiyanoiseasmr

ASMR | True Crime | The Oakland County Child Killer | Hubba-Bubba Gum chewing (unsolved mystery)

Dhiyanoiseasmr

Kixshani ASMR

Subs(2100) Views(380168)

Last Update (07/2021)

Dhiyanoiseasmr

I'm opening a new channel: bye bye KIXSHANI

New channel : http://www.youtube.com/hermetickitten Old channel : www.youtube.com/kixshani

Dhiyanoiseasmr

Apro un nuovo canale: ARRIVEDERCI KIXSHANI :')

ANNUNCIO IMPORTANTE! Apro un nuovo canale : Hermetic Kitten http://www.youtube.com/channel/UCR9ehrySGCcxFNg8gCA2rsQ/videos Kixshani resterà sempre aperto,ma tutti i nuovi video li caricherò sul nuovo canale! :) è un cambiamento molto importante e sono

Dhiyanoiseasmr

ASMR Lullaby-Ninna Nanna (multiple languages) with Blue Microphone

Volevo provare qualcosa di nuovo,quindi ho scelto alcune ninne nanne della mia infanzia in Francese,Inglese,Spagnolo ed Italiano,per il vostro rilassamento e farvi addormentare! :3 Hello! I wanted to try something different,so I picked some lullabies from

Dhiyanoiseasmr

fever dream ASMR

Subs(395) Views(23631)

Last Update (07/2021)

Dhiyanoiseasmr

i did not do drugs before filming this (chaotic and unpredictable ASMR)

wow my hair really is so frizzy wowowowow #asmr #chaotic #unpredictable

Dhiyanoiseasmr

ASMR what it's like working from home (whispering)

let me talk talk talk talk talk and hopefully you'll be relaxed

Dhiyanoiseasmr

ASMR touching pretty glass things (tapping, whispers, lid sounds, smoke)

im a little low energy in the video today, sorry about that. filming has been very difficult for me and i feel like i'm just doing the same things over and over. i hope you enjoy regardles Click here to skip gum chewing 08:50 00:00 intro 02:06 lighting an

Dhiyanoiseasmr

ASMR Interlude

Subs(2450) Views(167480)

Last Update (07/2021)

Dhiyanoiseasmr

[1 Minute ASMR] Sketching You

Hey everyone! Do you like this 1 minute ASMR trend? I think it’s super fun and useful if you wanna relax for a bit but don’t have a lot of time :)) Enjoy!

Dhiyanoiseasmr

[ASMR] Update!! :)

♥️♥️♥️

Dhiyanoiseasmr

[ASMR] Pokémon Cards & Monopoly Unboxing

Here is another long-awaited Pokémon video for you all!! Thank you for your patience. As I said in the video, it has been nearly impossible to find any cards, but I plan to keep making videos like this as soon as I find some more! Thank you for all the su

Dhiyanoiseasmr

North Star ASMR

Subs(1700) Views(212246)

Last Update (07/2021)

Dhiyanoiseasmr

My big return to ASMR!!! ?

This video did NOT go as smoothly as planned. Lol. ?? I ran into a lot of problems during filming including my camera not focusing properly + it overheated several times so this took hours to film, which you’ll see I’m filming during the day & at

Dhiyanoiseasmr

Drinking Wine & Talking Movies? (w/ Emmy Award) ASMR

Synopsis: Showing you guys a REAL Emmy Award while drinking wine & talking about movies! **I uploaded this mainly just for fun, to get drunk & ramble on about movies. Thumbs up if you make it through the whole video!! ? ** I don’t really recommend

Dhiyanoiseasmr

ASMR ~ Bubblegum Mixtape

❤ S U B S C R I B E ❤ This is a re-cut of all my previous bubblegum videos... all the best scenes together in one video. Hope you enjoy!

Dhiyanoiseasmr

Karen Singing ASMR

Subs(6110) Views(697521)

Last Update (07/2021)

Dhiyanoiseasmr

Slow ASMR cover of The Chauffeur by Duran Duran

Hey guys, what is up? I've captured for you some of Amsterdams more sinister sides to combine with this song, but the city obviously is gorge! I'm not back on the channel, this was just a song my loving husband really wished I make for his birthday, which

Dhiyanoiseasmr

? Relax with me and Austin with his ASMR Tongue Drum! ?

Please wear headphones for the binaural effect! Hey guys, I hope you like this collaboration with Tongue Drum Journey's Austin. He's an awesome being, and please go subscribe to him here: https://bit.ly/2zPVxsx There's also our second video there on his c

Dhiyanoiseasmr

Peek into the Berlin ASMR Spa

I want to thank Emma WhispersRed for setting up the most beautiful event ever, and the boys for making this lovely video for us! That's me in the thumbnail, having a break from back drawing and enjoying the sound session in the star room, and ASMR Paul :3

Dhiyanoiseasmr

Light of Heart ASMR

Subs(298) Views(10580)

Last Update (07/2021)

Dhiyanoiseasmr

Twin Yeti ASMR No Talking ♡ Ear cleaning and ear attention with inaudible whispers

Don’t mind me as I mumble along, cleaning your ears in the tingliest way I can ♡ If you enjoyed this video, please like it and subscribe to my channel. If you are interested in live, interactive ASMR then follow me on Twitch https://www.twitch.tv/ligh

Dhiyanoiseasmr

Visual ASMR || Brushing your face with feathers to celebrate Pride

I was so worried that I wouldn't have this edited before the end of June! But here it is. My contribution to Pride Month. It didn't turn out exactly as I wanted it to, but I wanted to share the sentiment anyway. Please note, this is a safe space. Any nega

Dhiyanoiseasmr

Twin Yeti ASMR || Mic scratching and mic blowing with mouth sounds and inaudible whispers

This is an excerpt from my live Twitch stream. If you enjoyed this video, please like it and subscribe to my channel. If you are interested in live, interactive ASMR then follow me on Twitch https://www.twitch.tv/lightofheartasmr. I would love to hear fro

Dhiyanoiseasmr

Judy asmr

Subs(305000) Views(39865041)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR(Sub) Mean ASMR Makeup Tutorial | 재수없는 친구 역할 메이크업 튜토리얼

[영상 속 제품 정보] *제품링크를 걸어드리려고 했는데 외국 제품이라 판매사이트 신뢰도도 잘 모르겠고, 무엇보다 재고가 없는 제품들이 많아서 일단 이름만 적어둘게요! - 파우더 : 메이크업 ??

Dhiyanoiseasmr

ASMR(Sub) 30만 구독자 축하 ? 우리 또 콜라보해요! | 300K Subs ? Let's Collab with Me!

30만 구독자 여러분들 모두 감사합니다 ? ◟( ˘ ³˘)◞ ? 앞으로도 열심히 영상 올려서 보답하도록 할게요- ! [구독자 콜라보 영상 참여방법] 7/18일 까지 Judyasmr@gmail.com 으로 여러분의 ASMR을 ??

Dhiyanoiseasmr

Super Mean Girl Does Your Makeup | 재수없는 친구가 해주는 메이크업(후시녹음)

*연기는 연기일 뿐 오해하지 맙시다 :). 자막을 키고 봐주세요! 자막에 오역이 있을 수 있습니다. * *Acting is acting, let's not misunderstand :) Please watch it with subtitles. There may be mistranslations in the subtitles.*

Dhiyanoiseasmr

Austrian ASMR

Subs(131000) Views(19139950)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Ich flüstere DICH in den Schlaf ❤? | Deutsch/German

Hi guys, und schön, dass ihr wieder für eine Potion Schlaf da seid. Dieses mal ein Video auf Deutsch! Ich hoffe euch gefällts und ihr könnt euch schön entspannen und einschlafen. Passt auf euch auf und bleibt gesund (: ?SOCIAL MEDIA Instagram: au

Dhiyanoiseasmr

ASMR Soft spoken Positive Affirmation ? | Everything is going to be fine

Hi guys, and welcome back to another video. ?SOCIAL MEDIA Instagram: austrianasmrgurl Twitch: AustrianASMR Discord: https://discord.gg/xX32dxnVeE Twitter: Austrianasmrgurl TikTok: austrianasmrgurl Tellonym: tellonym.me/ASMRGurl ?IF YOU WANT TO SUP

Dhiyanoiseasmr

ASMR Trigger Words Whispered ❤

Hi guys, and welcome back to another video! I'm really sorry for not being active for the last couple of weeks, I hope you still enjoy the video. Stay safe and healthy (: ?SOCIAL MEDIA Instagram: austrianasmrgurl Twitch: AustrianASMR Discord: https://

Dhiyanoiseasmr

Seafoam Kitten's ASMR

Subs(216000) Views(60304166)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - LITTLE RABBIT ~ Meeting a Weird Rabbit Person at Your Hotel ~

You're tired. You're just trying to get back to your hotel room when you're stopped in the hallway by a rather odd person. They are dressed up like a rabbit and call themselves Banana. Chuckling to themselves and speaking in breathy whispers, they seem to

Dhiyanoiseasmr

ASMR - FLUFFY SCALP MASSAGE ~ Brushing You to Sleep | May Patron Appreciation!

Thank you to my $5+ patrons of May, I appreciate you! Sorry this video is like two weeks late but hey at least I uploaded something this time :'DD anyway I hope you enjoy the fluffy ear massage! TIMESTAMPS: 0:59 - Reading your names 6:04 - Fluffy massage!

Dhiyanoiseasmr

ASMR - SAD BOI HOURS ~ Comforting You in the Night | 101 Reasons to Stay Alive ~

Your friend is here to comfort you during sadboi hours!! They give you some tea, silly gifts that make nice tapping sounds, and affirmations while reading a list of reasons to stay alive. I did not write this list!! I initially found this list from a you

Dhiyanoiseasmr

Ana ASMR

Subs(7120) Views(491607)

Last Update (07/2021)

Dhiyanoiseasmr

99,99% I swear you will tingle. Mastered audio. Inspired by SensorAdi ASMR (AGS, Echo)

Finaly 99,99 tingles. Inspired by SensorAdi ASMR. Like AGS (Asmr godlike style) Link SensorAdi channel : https://youtube.com/c/SensorAdiASMR I hope you enjoy it! ?Do not forget to subscribe ! And activate the bell, this way you will be noticed when

Dhiyanoiseasmr

Terapie pentru relaxare si dormire. Terapeuta doctor roleplay. ASMR in romana(relaxing therapy)

Terapeuta doctor roleplay in limba romana. Terapie pentru, stres, relaxare si dormire. Sper sa va placa și sa va relaxeze ? Daca esti pentru prima data pe canalul meu și nu ști ce înseamnă asmr, cauta pe google. Dacă ai întrebări Uite-te la vi

Dhiyanoiseasmr

ASMR Sunete relaxante cu CominAsmr. Adormi in 10 minute ?

Videoclip colaborare?. Sunete relaxante, mouth sounds, trigger word. A 2a parte a videoclipului pe canalul lui cominASMR: https://youtu.be/RBODf8KtE7A Canalul lui CominASMR https://www.youtube.com/channel/UCMZI3-oK7bmcM0xb1I3xjXA Sper sa va placa și

Dhiyanoiseasmr

Mr. Blue ASMR

Subs(18800) Views(2105491)

Last Update (07/2021)

Dhiyanoiseasmr

I'm Back! With Some Old School ASMR Triggers

Hi guys! It's been waaaay too long since I posted my last video. It was kinda awkward to record for the first time in months so please forgive me if it sucks! Anyways, it's good to be back! I missed you all. Hope you missed me too lol. Enjoy! And let me kn

Dhiyanoiseasmr

HAVANA... but ASMR

Heey! This song was highly requested so here it is! Enjoy :) Song: Camila Cabello - Havana Stalk me on instagram: ahsnightmare Check out my previous song but asmr: Dua Lipa - New Rules: https://youtu.be/7TOVbWeEC9w Lana Del Rey - Ride: https://youtu.b

Dhiyanoiseasmr

OLD SCHOOL ASMR MOUTH SOUNDS

Tonight's video is an old school ASMR mouth sounds - up close, no professional mic. Hope you gonna enjoy it. Give me some love in the comments if you do! and don't forget to HIT it baby one more time. I mean, the thumb up. Love you. Goodnight. Stalk me on

Dhiyanoiseasmr

Meganbeenthinkin ASMR

Subs(8000) Views(365485)

Last Update (07/2021)

Dhiyanoiseasmr

LIVESTREAM

What is up Goofy Goobers! Today we are talking about a million and one topics! You ROCK! ---------------------------------------------------------------- Special thanks to my awesome Patrons! GOOFY GOOBER - JERRY THE HOMIE - TALIA GOOFY GOOBER - JAY GOOF

Dhiyanoiseasmr

ASMR To Be in The Moment | Positive Affirmations

ASMR To Be in The Moment | Positive Affirmations Personal Attention, Eye Covering, Face Touching, and Guided Thinking. Volume up! Heads down! It's bedtime! ---------------------------------------------------------------- Special thanks to my awesome Pa

Dhiyanoiseasmr

I've Been Wanting To Do A Driving Vlog So Here It Is!

MeganBeenDrivin. I've got a lot of driving on my hands while livin in hawaii, so I think driving vlogs will become a thing! Lets get into it ---------------------------------------------------------------- Special thanks to my awesome Patrons! GOOFY GOOBE

Dhiyanoiseasmr

CrinklesForTingles

Subs(1030) Views(154011)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Harry Potter Ambience??Christmas at the Burrow: Ron's Bedroom (crinkling, wind howling + more)

Enjoy Christmas at the Weasleys with Ron and Harry at the Burrow. Listen for the crinkling of wrapping paper, Scabbers running around, and Hedwig flying over the Burrow in the snowy night. See if you can spot Santa! Relax with the Christmas music from the

Dhiyanoiseasmr

Teen Wolf ASMR | Derek's Loft - Stormy Full Moon Ambience | rain, thunderstorm, atmospheric sounds??

Escape into Derek Hale's dark but cozy loft on a stormy full moon night in Beacon Hills. Don't get too disrupted by the sirens and whoever is trying to contact Derek. Scott maybe? Don't worry, whatever is happening in Beacon Hills tonight, you will be safe

Dhiyanoiseasmr

ASMR // Teen Wolf Ambience - Rainy Night in Stiles' Jeep ?? (Rain on Car Window, Police Radio)

** All of these videos, audios and photographs DO NOT belong to me. Copyrights and Credits to the original owners. Please check out ASMR Radio's channel where I discovered the police radio recordings! Copyrights and Credits go to them for those recordings:

Dhiyanoiseasmr

Psk. ASMR HYPNOSİS

Subs(515) Views(25494)

Last Update (07/2021)

Dhiyanoiseasmr

#ASMR Rahatlatıcı sürpriz hediye?! Stres alan Sihirli kelimelerle seni uyutuyorum#TürkçeAsmr#uyku

??‍Videomu izleyen Güzel insan; Asmr keyfine hoşgeldin, Senin için aldığım rahatlatıcı hediyeyi açıyoruz sen beni izlerken kutunun icindekini tahmin etmeyi unutma ve hediye açıldıktan sonra Rahatlatıcı uyku öncesi seansini kaçır

Dhiyanoiseasmr

ASMR UYKU GETIREN KÜTÜPHANECi ROLEPLAY #TürkçeAsmr#Fısıltı#Rahatuyku

??‍Videomu izleyen Güzel insan; Asmr keyfine hoşgeldin, Abone olduğun için teşekkürler,✨ Huzurlu seyirler ? Kanalımda ki diğer içerikler için; İletişim: vikiasmr2020@gmail.com ✨Kişilik testi-1 videom; https://youtu.be/vaErCk

Dhiyanoiseasmr

ASMR UYKU ROBOTU seni Hipnozla uyutuyor #Roleplay #TürkçeAsmr#Hipnoz

??‍Videomu izleyen Güzel insan; Asmr keyfine hoşgeldin, ASMR Robot Roleplay videom da spiral background eşliğinde etkileyici bir HİPNOZ deneyimi yaşayacaksınız. Abone olduğun için teşekkürler,✨ Huzurlu seyirler ? Kanalımda ki

Dhiyanoiseasmr

kkybik ASMR

Subs(3860) Views(689290)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Boyfriend Roleplay // sign language

Girls, next time lets try to be more peaceful in nervous situation with your boyfriend. This ASMR role play special for you! https://vk.com/m.novelisky - я ВК https://www.instagram.com/novelisky/ - инстаграм

Dhiyanoiseasmr

АСМР мешок для удовольствий!

Я нашел эту небольшую сумку с разными предметами для АСМР... давайте заглянем? https://vk.com/m.novelisky - я ВК https://www.instagram.com/novelisky/ - инстаграм

Dhiyanoiseasmr

Новогодний АСМР!!! Новогодняя АСМР ночь.

Дорогие друзья! Поздравляю Вас с 2017 годом. Желаю всего самого наилучшего. Любите и проявляйте заботу друг к другу - в этом смысл жизни. Спасиб

Dhiyanoiseasmr

Lara Soft ASMR

Subs(2380) Views(94269)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Random Personal Attention with touching, plucking, measuring, brushing for deep relaxation

————————-— *CUSTOM VIDEOS ON MY PATREON* ————————— ??? larasoft_asmr ——————————-— ??????? ?? ——————————— ? *DONATE* or leave a tip f

Dhiyanoiseasmr

ASMR Deutsch / German | Ich kühle dich ab! Flüstern, Trigger & Personal Attention #asmrdeutsch

————————-— *CUSTOM VIDEOS ON MY PATREON* ————————— ??? larasoft_asmr ——————————-— ??????? ?? ——————————— ? *DONATE* or leave a tip f

Dhiyanoiseasmr

ASMR Detsch / German | ?Lara's Love Talk Teil 2! ?Die grosse Liebe & Herzschmerz #asmrdeutsch

So, Schnarchhasis! Tadaaa viel Spass bei Teil 2 von Lara's Love Talk ASMR ;-p Im nächsten Teil gehts dann um Tinder Dates... ;-p ————————-— *CUSTOM VIDEOS ON MY PATREON* ————————— ??? larasoft_asmr ——??

Dhiyanoiseasmr

Soft ASMR

Subs(165000) Views(30753132)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Trying Snacks From the Netherlands ??

? My Last Video: *updated* What's On My iPhone? ➜ https://www.youtube.com/watch?v=YMNyYFdWYvw Get your own box: https://www.trytreats.com?aff=51 Use my code 'SOFTASMR15' for 15% off your first box! :) WHAT I'M WEARING: TOP: https://api-shein.shein.

Dhiyanoiseasmr

ASMR *updated* What's On My iPhone?

? My Last Video: Neighborhood Gossip Part 2 ➜ https://www.youtube.com/watch?v=FoXwSZSz9L8 WHAT I'M WEARING: DRESS: NECKLACES: https://amzn.to/3ohEpmN​, https://amzn.to/35gkRYu EARRINGS: https://amzn.to/3mwKR8b LIPS: NYX Liquid Suede in Sandstorm

Dhiyanoiseasmr

ASMR - Neighborhood Gossip Part 2

? My Last Video: GRWM | Everyday Makeup Chit Chat ➜ https://youtu.be/4JGuxC_WZDQ Mary’s Neighborhood Gossip: https://www.youtube.com/watch?v=szEx0ZV1ECI&list=LL&index=56&t=721s Part One: https://www.youtube.com/watch?v=a9NtfcEWVr0&t=478s WHAT I'M

Dhiyanoiseasmr

Emma Simple ASMR

Subs(2110) Views(251731)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR- Relaxing hypnosis with mouth sounds ?

pls sub if u like lofi asmr ? IG: emmasimpleasmr

Dhiyanoiseasmr

ASMR- Personal attention♥️tracing, touching and brushing your face

pls sub if u like lofi asmr? IG: emmasimpleasmr

Dhiyanoiseasmr

ASMR- Very lofi breathy whispers

the mini mic is broken, I noticed that after filming! Please sub ifu like lofi asmr ♥️ IG: emmasimpleasmr

Dhiyanoiseasmr

Binaural Eats ASMR

Subs(78900) Views(14350201)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR: AMISH BREAKFAST CASSEROLE (EATING SOUNDS) STORYTIME~SOFT SPOKEN

Hi everyone. In this ASMR video I'm eating a delicious Amish Breakfast Casserole that my wife made for me. I also tell a story about my dad and some of the cool things that I have of his. I hope you like it. Sit back, relax and enjoy the video. Sleep well

Dhiyanoiseasmr

ASMR: ALL NEW~RELAXING SOLITAIRE/EATING CHEWY CANDY~SOFT SPOKEN/WHISPER

Hi everyone. Join me in this ASMR video for a few games of Solitaire. Hopefully I can win a game or two. As always I'll be eating a variety of chewy candy while I play the games. I'm having Swedish Fish, Starburst Fruit Chews and Hi-Chew candy. Sit back, r

Dhiyanoiseasmr

ASMR: OIKOS GREEK YOGURT WITH CRUNCHY APPLES AND ALMONDS (EATING SOUNDS) SOFT SPOKEN

Hi everyone. In this ASMR video I'm having a delicious healthy snack for lunch. I'm eating some Oikos Greek Yogurt with crunchy apples and almonds. I hope you like it. Sit back, relax and enjoy the video. Sleep well my friends. Please like, comment and su

Dhiyanoiseasmr

novaruu asmr

Subs(11600) Views(1052035)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Aggressive Ear Licking & Eating From Your Cute Blue Hair Girlfriend

If you like what I do and want to support me, I have a fans page that I am sure you'd enjoy. You can find all my links at https://novaruu.com/links My links: ➜ Non-ASMR Youtube- @Novaruu ➜Twitch- https://bit.ly/2YFR4DO ➜Twitter- https://bit.ly/2Y

Dhiyanoiseasmr

ASMR Bedtime Story | Brushing | Positive Affirmations

If you like what I do and want to support me, I have a fans page that I am sure you'd enjoy. You can find all my links at https://novaruu.com/links Business Inquiries only: novaruuofficial@gmail.com Edited by Watson - contact hwatsonofficial@gmail.com My

Dhiyanoiseasmr

ASMR Ear Eating & Licking ??(Kisses, mouth sounds, TINGLY Nom Noms)

If you like what I do and want to support me, I have a fan page that I am sure you'd enjoy. You can find all my links at https://novaruu.com/links Business Inquiries only: novaruuofficial@gmail.com My links: ➜ Non-ASMR Youtube- @Novaruu ➜Twitch- h

Dhiyanoiseasmr

Camilla ASMR

Subs(861) Views(95788)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Crushing Trample with Heeled Sandals Banana peels Relaxation Sounds

Scusate per le mie assenze ma sono settimane difficili per me e lo saranno sempre di più ma farò il possibile per portare qualche video per voi:) Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi vid

Dhiyanoiseasmr

ASMR My Cat Eating a Meat Stick and Soft Spoken ITA ASMR with My Cat Mia

Oggi video un pò diverso dal solito sarà breve ma vi mostro come do da mangiare uno snack al mio gatto Mia. Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi video :) Per richieste video Custom con d

Dhiyanoiseasmr

ASMR Relaxing Neck & Shoulder Massage Personal Attention Relaxing Massage with Oil

Spero di potervi rilassare con questo delicato massaggio al corpo:) Se il video vi è piaciuto lasciate like e iscrivetevi al mio canale per supportarmi e non perdere nuovi video :) Per richieste video Custom con donazione contattatemi via Email: camilla.a

Dhiyanoiseasmr

Miss Sammi ASMR

Subs(1330) Views(75426)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] CALMING CANDLE COLLECTION ? LIGHTER, TAP, GLASS & WOOD CANDLES: DEEP RELAXATION & SLEEP

Thanks for watching Please subscribe and turn on your bells ? #candle #asmr #firetriggers #fire #triggers #tingles

Dhiyanoiseasmr

[ASMR] RELAXING LIVE VIDEO ROLEPLAY W/PS4 CONTROLLER SOUNDS & CHEWING GUM | TINGLES

Thanks for watching Please subscribe and turn on your bells ? As always, Let me know what you want to see next!!! Love Miss Sammi ???❤️ #asmr #roleplay #ps4controller #controllersounds #chewinggum #asmrgum

Dhiyanoiseasmr

[ASMR] SCARY STORYTIME W/REAL RAIN & CHEWING GUM SOUNDS “I THINK SOMEONE LIVES IN MY ATTIC” WHISPERS

Thank you for watching!! I love you ? Miss Sammi #asmrstorytime #scarystory #asmr #whispered

Dhiyanoiseasmr

Happy Asmr

Subs(128) Views(3718)

Last Update (07/2021)

Dhiyanoiseasmr

✨ASMR Mouth Sounds 2 Layer✨

Thanks guys for 100 really do appreciate it hopefully you enjoyed and have a great night.

Dhiyanoiseasmr

✨ASMR Calm Mouth Sounds✨

Thanks for watching guys i really do appreciate all the support? If you are new don't forget to leave a like and sub to show your support thanks and have a great day.?

Dhiyanoiseasmr

✨Inaudible Whispering and mouth Sounds✨

Hello cutie :)??

Dhiyanoiseasmr

Rayy SMR

Subs(18800) Views(4912588)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Weird Fruit and a Binaural Walk in a Rainforest

Hello! This would have been uploaded yesterday, but I need to buy better internet. The upload speed couldn't handle all this fruity goodness. Hope no one else in these apartments needed to use the internet! - - - - - Hi, my name is Sunny and I make this

Dhiyanoiseasmr

ASMR - New Microphone Test (Audio Only)

Hello! This was made pretty last minute in order to have something. It has been a crazy week and I'm really not feeling well today, but at least I could accomplish something! : ) I got a new microphone and I wanted to test out its quality for speech. It a

Dhiyanoiseasmr

ASMR - Moody Artist Works on You (Scratching, Scraping, Brushing, Quiet Whispers)

This video was the first major wake-up call that the space I am in (and/or the way the space is being utilized) is utterly inefficient. There are reasons, some of which are not easy to get around at the moment, but everything is about to shift and then mor

Dhiyanoiseasmr

Luminin - ASMR Let's Plays

Subs(5600) Views(1328723)

Last Update (07/2021)

Dhiyanoiseasmr

The NAMELESS King... ASMR Edition?! | ASMR Dark Souls 3 | ASMR Gaming & Let's Play

ASMR Dark Souls 3 is part of an ASMR Let's Play & Gaming series designed for relaxation. ► Check out the full playlist, including ASMR Dark Souls 3 : https://www.youtube.com/playlist?list=PLu33DZHAUNamH3wox08pRcFiznVNicQ9I ► Want to see a game like ou

Dhiyanoiseasmr

Diablo ROBBED Me Of MVP?! | ASMR Heroes Of The Storm | ASMR Gaming & Let's Play

ASMR Heroes Of The Storm is part of an ASMR Let's Play & Gaming series designed for relaxation. ► Check out the full playlist, including ASMR Heroes Of The Storm : https://www.youtube.com/playlist?list=PLu33DZHAUNakN_gXTQI7J8Ce4sXgChytO ► Want to see

Dhiyanoiseasmr

Upcoming PORT-A-FORT Update Hype! | ASMR Fortnite Battle Royale | ASMR Gaming & Let's Play

ASMR Fortnite Battle Royale is part of an ASMR Let's Play & Gaming series designed for relaxation. ► Check out the full playlist, including ASMR Fortnite Battle Royale : https://www.youtube.com/playlist?list=PLu33DZHAUNam2sv1J5ihDhByBqxDm8pEh ► Want t

Dhiyanoiseasmr

GusBR ASMR

Subs(13200) Views(1280802)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR AO VIVO - RELAXE ESTA NOITE com GusBR ASMR

AJUDE O CANAL DE GRAÇA!! Cadastre-se no tiktok com meu link!!! https://vm.tiktok.com/ZMduAbxXj/ Fiquem atentos!!!! Email para contato: gustavoasmr@gmail.com O que é ASMR? ASMR significa Autonomous Sensory Meridian Response. É uma palavra não ci

Dhiyanoiseasmr

LIVE ASMR GUS BR PARA ACALMAR SUA NOITE

Vídeo da Andris - https://youtu.be/CCfdcGiCs68 AJUDE O CANAL DE GRAÇA!! Cadastre-se no tiktok com meu link!!! https://vm.tiktok.com/ZMduAbxXj/ Fiquem atentos!!!! Email para contato: gustavoasmr@gmail.com O que é ASMR? ASMR significa Autonomous

Dhiyanoiseasmr

ASMR Binaural ? Whisper Ear to Ear (AVISO LIVESTREANS)

Cadastre-se no tiktok com meu link!!! https://vm.tiktok.com/ZMduAbxXj/ Aguardem novidades este final de semana!!!! Fiquem atentos!!!! Email para contato: gustavoasmr@gmail.com O que é ASMR? ASMR significa Autonomous Sensory Meridian Response. É um

Dhiyanoiseasmr

DuckMarbles ASMR

Subs(2310) Views(155667)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Medical Roleplay- Nervous and Tired Nurse Helps On His First Day

I wanted to switch things up and do something a little bit different than the regular medical videos I do! I left a poll to decide between this or a comfort video, so next week will be some comfort ASMR! Also please excuse the sunbirn...it kinda looks lik

Dhiyanoiseasmr

When You Try To Make A Video, But Get Distracted

I sat down to make a video and....well.....I got side tracked....

Dhiyanoiseasmr

ASMR Barber Roleplay- Giving You A Haircut (with background storm sounds)

snip snipsnip snipsnipsnip snipsnipsnipsnip snipsnipsnipsnipsnip snipsnipsnipsnipsnipsnip snipsnipiloveyousnipsnipsnip snipsnipyouresuchacutiesnipsnip snipsnipsnipwinkyfacesnipsnipsnipsnip __________________________________________________ If you enjoy

Dhiyanoiseasmr

Twinkle ASMR

Subs(4760) Views(239070)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR MIT DIESEM VIDEO WIRST DU SCHNELL EINSCHLAFEN ?? | Twinkle ASMR

Hey du, in diesem Video werde ich dir mit diversen Triggern beim Einschlafen helfen ? Ich hoffe deine Lieblingstrigger sind mit dabei Schönen Abend und schlaf gut ! xoxo Lisa Über ein Abo oder ein Like würde ich mich sehr freuen, sowie Feedback in

Dhiyanoiseasmr

ASMR| DU bist meine Leinwand! Und Ich mache ein Kunstwerk aus DIR ?✨|Twinkle ASMR

Hey DU ? Heute kümmere ich mich um dein wunderschönes Gesicht und werde es ein bisschen bunter machen ? Ich hoffe es wird dir gefallen! xoxo Lisa #asmr #asmrdeutsch #painting Instagram? https://www.instagram.com/yt_twinkleasmr/

Dhiyanoiseasmr

ASMR| Das musst DU wissen!? Ich flüstere DIR lustige Fakten über mich ins Ohr???| Twinkle ASMR

Hey ihr Lieben ? Heute werde ich euch einige lustige und random Fakten über mich erzählen. Ich hoffe euch gefällt das Video und ich konnte euch mit meiner flüster Stimme etwas müde machen und ihr könnt gut schlafen ?? xoxo Lisa #asmr #asmr

Dhiyanoiseasmr

AndressASMR

Subs(100000) Views(8491916)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Guiado: Mouth Sounds & Hand Movements

hj tem participação especial e meu insta eh @_andressao beijos de queijo sem lactose pois sou intolerante

Dhiyanoiseasmr

ASMR CRANIAL NERVE EXAM - very relaxing

instagram: @_andressao

Dhiyanoiseasmr

ASMR: LIMPEZA DE OUVIDO

Dhiyanoiseasmr

asmrlovely

Subs(3190) Views(260912)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Gym Membership Consultation & Sign Up ? // Measuring You Roleplay

Hello Lovelies! I hope you enjoy ASMR | Gym Membership Consultation & Sign Up ? // Measuring You Roleplay Welcome to the Lovely Gym! I think I know just the right thing for you and your fitness goals. Join me in your gym consultation and sign up to rec

Dhiyanoiseasmr

ASMR | Men's Shave Barber Shop Roleplay ? | Beard Shave, Trim, & Style

Hello Lovelies! I hope you enjoy ASMR | Men's Shave Barber Shop Roleplay ? | Beard Shave, Trim, & Style Welcome to the Men's Shave Barber Shop! Today I will be helping you with your beard by providing you with an all inclusive beard shave, trim, and st

Dhiyanoiseasmr

ASMR | Night Nurse Takes Care of You In Bed ♥ // Nurse Checkup Medical Routine

Hello Lovelies! I hope you enjoy ASMR | Night Nurse Takes Care of You In Bed ♥ // Nurse Checkup Medical Routine Shhhh...it's 11 PM and your night nurse is here to take care of you [in bed]. I hope you are enjoying your hospital visit so far. Sorry to wa

Dhiyanoiseasmr

ASMR da Maru

Subs(92200) Views(5836244)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR, VAPE, FOFURA e FUMAÇA ❤️?

INSTAGRAM https://www.instagram.com/oieusoumaru Twitter https://twitter.com/oieusoumaru Editor Instagram @philkarv

Dhiyanoiseasmr

PRESENTINHOS QUE GANHEI DO MEU AMOR

INSTAGRAM https://www.instagram.com/oieusoumaru Twitter https://twitter.com/oieusoumaru Editor Instagram @philkarv

Dhiyanoiseasmr

ASMR CAIXINHA DE MUSICA E Whispering

INSTAGRAM https://www.instagram.com/oieusoumaru Twitter https://twitter.com/oieusoumaru Editor Instagram @philkarv

Dhiyanoiseasmr

Yoloma ASMR

Subs(814) Views(36288)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR The Sculptor (Sculpting Your Face ASMR Roleplay)

#asmr #personalattention #asmrroleplay This is the long version of The Sculptor roleplay from the Mega Collaboration organized and hosted by ASMR Alysaa. Watch the full collaboration here to discover 50+ asmrtists : https://youtu.be/sod3fo_Rxz0 and visi

Dhiyanoiseasmr

ASMR Pop the Popsicle ! Satisfying ASMR Fidget Toy #shorts

#asmr #shorts #short #asmrshort #asmrshorts #1minuteasmr #youtubeshorts #asmrtoy #satisfyingasmr A satisfying ASMR toy ! Pop the popsicle ! Sensory popping toy ! Go pop ! Pop it ! Fidget toy ! No talking and lo-fi ! Follow me on Twitter : @ASMRYoloma Wan

Dhiyanoiseasmr

ASMR Love Apothecary (Medieval Fantasy Roleplay from Spring Elven Festival @ Whisperwind ASMR)

#asmr #roleplay #medievalfantasy #elf #renaissancefair #springfestival #softspoken This is the short version of my part in the Elven Spring Festival ASMR collaboration organized by Whisperwind ASMR. I am the elf tenant of the Love apothecary and I’ll pr

Dhiyanoiseasmr

Purple Dream ASMR

Subs(1370) Views(106241)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Brushing my Hair ? No Talking

? Violetta ASMR - https://www.youtube.com/c/ViolettaASMR ? Violetta PLAY - https://www.youtube.com/c/ViolettaPLAY ? Twitch - https://www.twitch.tv/violetta_purpur ? Instagram - https://www.instagram.com/violetta_purpur/ ?Facebook - https://w

Dhiyanoiseasmr

ASMR Cosmic Tuning Fork ? No Talking

? Violetta ASMR - https://www.youtube.com/c/ViolettaASMR ? Violetta PLAY - https://www.youtube.com/c/ViolettaPLAY ? Twitch - https://www.twitch.tv/violetta_purpur ? Instagram - https://www.instagram.com/violetta_purpur/ ?Facebook - https://w

Dhiyanoiseasmr

ASMR Scalp Inspection, Lice Check, Hair Brushing ? No Talking

Triggers in this video: Scalp Inspection, Scalp Massage, Lice Check, Personal Attention, Hair Brushing ? Violetta ASMR - https://www.youtube.com/c/ViolettaASMR ? Violetta PLAY - https://www.youtube.com/c/ViolettaPLAY ? Twitch - https://www.twitch

Dhiyanoiseasmr

JasonCreation ASMR

Subs(459) Views(23407)

Last Update (07/2021)

Dhiyanoiseasmr

[ASMR] Yu-Gi-Oh! in 2005 | Shuffling & Test Hands

My Yu-Gi-Oh! video's got quite popular, so it was time for another upload! This time we touch a little bit of nostalgia by going back to how Yu-Gi-Oh! was played in 2005. This was known as GOAT format. This was named after the card "Scapegoat". Some might

Dhiyanoiseasmr

[ASMR] 1-Hour HAND SOUNDS ONLY

Hi! This video is a big compilation of 4 hand sounds only video's I made since the beginning of the channel. I know some people like to have a video up while sleeping, so thought this was a great idea for everyone! Enjoy some crispy hand sounds, finger flu

Dhiyanoiseasmr

[ASMR] Pay Attention & Focus | Fast & Aggressive

Focus! Pay Attention to me. Follow my instructions while I guide you to staying aware. Stay in the moment with me, and everytime I see you slip away, I ask you to pay attention again. This one is fast paced, with high energy. Enjoy :) -------------------

Dhiyanoiseasmr

ASMR 도령도령

Subs(1080) Views(73115)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR 자기 전에 귀 파드립니다/??? 시각적 귀파기 상황극/귀청소 가게 롤플레이/Ear cleaning rol

안녕하세요 여러분 오늘은 시각적 귀청소 가게 영상을 찍어 봤습니다 배경조명을 새로 바꿔 봤는데 맘에 드시는지 궁금합니다! 그리고 업로드 날짜를 수요일과 토요일로 정할까 합니다 오늘도

Dhiyanoiseasmr

ASMR 팅글 오는 귀청소 해드릴게요/귀파기 양쪽 강하게 no talking /면봉,핀셋,가위

안녕하세요 여러분 오늘은 강하고 자극적인 no talking 귀파기 영상을 찍어봤습니다 최근에 조명을 하나 더 샀는데 색깔이 엄청 여러개 나오거든요? 배경 색깔을 조금 바꾸고 싶어서 산건데 결국 ?

Dhiyanoiseasmr

ASMR 화장이 서툰 손님, 상담가득한 메이크업샵 /롤플레이 후시녹음/make up asmr roleplay sub_

안녕하세요 여러분 오늘은 상담+키보드 소리+메이크업 영상입니다 롤플레이 영상은 찍을 때 마다 재밌는 거 같네요 아직 연기가 어색하긴 하지만..^^ 영상 요청해 주신 분! 마음에 드셨으면 좋겠

Dhiyanoiseasmr

Valeriya ASMR

Subs(866000) Views(224009862)

Last Update (07/2021)

Dhiyanoiseasmr

Dive in my ASMR ? Why is my ASMR so special?

We are all special and that's why we are here. Let's plunge into the world of my ASMR and I will show you new sensations. 00:00 let’s dive in 01:21 why you are here 02:23 what is the purpose of ASMR 03:47 who is ASMR for 05:44 where does ASMR come from 0

Dhiyanoiseasmr

#shorts ONE MINUTE ASMR ⏰?

A little warm-up before Sunday video for you. Fast triggers in 1 minute. I hope you will enjoy. #asmr #shorts

Dhiyanoiseasmr

ASMR You’re too thorny ? Cleaning and trimming your bush ? rose-play ?

Install Raid for Free ✅ Mobile and PC: https://clik.cc/Qe47P and get a special starter pack ? Available only for the next 30 days ? You are so thorny. Let's trim your thorns and leaves! Today I will pamper you: clean your leaves and buds, trim you

Dhiyanoiseasmr

Life & Love journey ASMR

Subs(2480) Views(402530)

Last Update (07/2021)

Dhiyanoiseasmr

Asmr OTOSCOPE/DEEP EAR Picking/Cleaning (no talking)

#asmr #asmrearexam #asmrearcleaning #asmrotoscope I hope you all enjoy this longer non talking ear picking session. sent with lots of love ???

Dhiyanoiseasmr

ASMR CLOSE WHISPER

#asmr #asmrearexam #asmrwhisper

Dhiyanoiseasmr

ASMR Scalp EXAM

#asmr #asmrexam #asmrscalp Hope you enjoy the audio guys ?????

Dhiyanoiseasmr

Atmosfera ASMR

Subs(11000) Views(373409)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Dentista Atencao Pessoal Atmosfera Asmr Roleplay

ASMR Dentista Voz suave Roleplay Atmosfera Asmr Video de ASMR com voz suave para relaxar sentir arrepios e dormir rapido. Sons relaxantes oara dormir Asmr com roleplay atencao pessoal dentista atendendo voce sm relaxante teclado scratching Asmr soft spoken

Dhiyanoiseasmr

ASMR Lendo para voce dormir Chuva SUSSURROS Reading Whispering

ASMR Lendo para voce dormir SUSSURROS Video de ASMR com leitura sussurrando de orelha a orelha para relaxar ter arrepios e dormir rapido. Asmr ear to ear com sussurros e lendo livro. Asmr lendo para dormir Video de Asmr para relaxar arrepiar com leitura

Dhiyanoiseasmr

ASMR COMPRINHAS Sussurros intensos para dormir Atmosfera Asmr

ASMR COMPRINHAS Sussurros intensos para dormir Atmosfera Asmr Video de Asmr mostrando comprinhas com sussurro intenso para relaxar arrepiar e dormir rapido. Asmr sussurrando no seu ouvido para relaxar e dormir em poucos minutos. Video mostrando objetos de

Dhiyanoiseasmr

FashionEats/ASMR

Subs(158) Views(3902)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR/CHILLI CHEESE HOT DOGS+CRUNCHY TOTS! (Eating sounds) Yummy!

Hey guys!!! Look what we have today! ??? #asmr #mukbang #foodie

Dhiyanoiseasmr

ASMR/CHEESY CHICKEN SPAGHETTI (eating sounds) YUMMY!

Hey guys! Today we have a cheesy chicken spaghetti dinner with green beans and garlic bread! I hope you all enjoy this video! ? ASMR! #ASMR #EATING #FOODIE

Dhiyanoiseasmr

ASMR/SEAFOOD IN B-LOVES SAUCE/ (serious eating sounds) BEWARE!

Hey everyone! Today's ASMR has lots of slurping, gulping and smacking eating sounds! This was so delicious! I hope you all enjoy! Happy Belated Mothers Day to the Mommies! ❤ #ASMR #Seafoodboil #blovessauce

Dhiyanoiseasmr

Eun ASMR

Subs(1030) Views(71859)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | 테이프로 귀청소? | Ear Cleaning sounds with Tape | Sticky Sounds | 고인물 asmr | Tascam | No Talking

?Don't forget to set the resolution to 1080&wear headphones. 화질 1080 설정과 이어폰 착용 잊지마세요? ? 6/10 volumes are recommended. 볼륨은 최대 6/10 추천합니다 ? 안녕하세요 여러분~~~ 오늘도 요청영상이

Dhiyanoiseasmr

ASMR | (요청영상) 마사지볼 마이크 스크래칭✨| 귀가 간질간질 | Mic Scratching | 1K special | Tascam | No ta

?Don't forget to set the resolution to 1080&wear headphones. 화질 1080 설정과 이어폰 착용 잊지마세요? ? 6~7/10 volumes are recommended. 볼륨은 최대 6~7/10 추천합니다 ? 안녕하세요? 이번 영상은 구독자분?

Dhiyanoiseasmr

ASMR | 핀마이크 테스트 | 주사기로 긁기, 브러슁, 솜털귀청소 | New Mic Test | Scratching, Brushing, Ear Clean

?Don't forget to set the resolution to 1080&wear headphones. 화질 1080 설정과 이어폰 착용 잊지마세요? ? 7/10 volumes are recommended. 볼륨은 최대 7/10 추천합니다 ? 안녕하세요 여러분!! 오늘 영상은 핀마이

Dhiyanoiseasmr

MSP Eats ASMR

Subs(1110) Views(77535)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Eating (Mukbang 먹방) | Korean Corndogs and Mozzarella Dogs

Please watch in 4K. Food: Korean Corndogs and Korean Mozzarella Dogs Source: Home Made! Background Song: Last Night - Lakey Inspired Website: (https://soundcloud.com/lakeyinspired/last-night) Quick note about ASMR: Autonomous sensory meridian respons

Dhiyanoiseasmr

ASMR Eating (Mukbang 먹방) | Magnum Ice Cream

Please watch in 4K. Food: Magnum Ice Cream Bars (Double Caramel, Double Chocolate, Raspberry) Source: Grocery Store Background Song: Chilled - DJ Quads Website: (https://soundcloud.com/aka-dj-quads/chilled) Quick note about ASMR: Autonomous sensory m

Dhiyanoiseasmr

ASMR Eating (Mukbang 먹방) | Pizza. Meatball and Ricotta.

Please watch in 4K. Food: Pizza. (Meatball, Ricotta, Basil, Parmesan, Crush Red Peppers) Source: Black Sheep Coal Fired Pizza Background Song: Dreamer - DJ Quads Website: (https://soundcloud.com/aka-dj-quads/dreamer) Quick note about ASMR: Autonomous

Dhiyanoiseasmr

SUNFLOWER ASMR

Subs(1870) Views(177820)

Last Update (07/2021)

Dhiyanoiseasmr

GIRLFRIEND PLAYS ANIMAL CROSSING SO YOU CAN FALL ASLEEP ROLEPLAY | ASMR

so i’ve been wanting to do more roleplay but i’m not sure which ones and if i even do them good so let me know if you guys enjoyed it and give me some suggestions down below :)?

Dhiyanoiseasmr

ASSORTMENT TRIGGERS FOR YOUR PLEASURE | ASMR

happy one year to all of us! thank you so much for the love and support and i can’t wait for what the future holds. thank you again for sticking with me :) ?

Dhiyanoiseasmr

MOUTH SOUNDS + GUM CHEWING + RAMBLE | ASMR

and here i am back again :) anyways for real this time i will be back let’s just hope i don’t get locked out of my gmail accounts! goodnight and i hope you all are well rested ?

Dhiyanoiseasmr

ASMR Mistress

Subs(1420) Views(187541)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Hairbrushing | Hair Play | Hair over Face PART 2 #asmrhairbrushing #hairtingles

Part 2

Dhiyanoiseasmr

ASMR Hairbrushing | Hair Play | Hair over face Scratching PART 1 #asmrtingles #hairoverface

Hello All I have had to split my video into two parts as I couldn’t upload it as one video It just wouldn’t upload So there is a part 1 and part 2 Please comment and let me know what you think ❤️❤️

Dhiyanoiseasmr

ASMR ~ Brush my hair with me | Hair play

#asmrtingles #asmrhairbrushing #asmrHairplay Hi everyone it’s been a while since I uploaded a hair brushing video but here is one ???

Dhiyanoiseasmr

2Lips ASMR

Subs(887) Views(156239)

Last Update (07/2021)

Dhiyanoiseasmr

|ASMR Flirty Roleplay| Parent Teacher Conferences| Gum Chewing & Snapping

Hey there 2Lips!! Hope you enjoyed! It was so much fun making!! Sending my love and thanking you for your continuous support by Subscribing, liking, sharing, and commenting on my videos!! As Always, Xoxoxoxo ???

Dhiyanoiseasmr

Good Morning Sunshines ASMR Eating Dunkin’ Donuts Breakfast (no talking)

Rise and Shine?☀️ Love dining with you all anytime of day!! Hope you loved the video! Lmk what other vids you’d like to see! Don’t forget your subscriptions likes shares comments help support this Channel so pls continue it is all appreciated

Dhiyanoiseasmr

ASMR FEET CANDY #shorts

Dhiyanoiseasmr

Klee ASMR

Subs(3290) Views(205882)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR A Quiet Place ROLEPLAY

Dhiyanoiseasmr

ASMR singing you to sleep

Sleep well luvs

Dhiyanoiseasmr

ASMR/ Pick me girl rp part 3

I know its short but I’m running out of ideas for this character. I hope you enjoy anyway! Love y’all

Dhiyanoiseasmr

LunaRexx ASMR

Subs(162000) Views(20984573)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Black Widow Calms YOU Down ? (Face Touching & Soft Spoken, Up Close Personal Attention)

Shh I am here to calm you down tonight. If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PATREON (60+ EXCLUSIVE ASMR VIDS & COSPLAY) ? https://www.p

Dhiyanoiseasmr

ASMR Tattoo Tracing on my Body to Give YOU Tingles ✏️? (Skin Sounds, Visual Triggers, Whispered)

I hope you like my new ink ? Enjoy this tingly experience. Thanks for watching! If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PATREON (60+ EXCLUS

Dhiyanoiseasmr

ASMR FOLLOW MY SIMPLE INSTRUCTIONS...again ?? (for Sleep & Tingles)

You must listen and follow all of my instructions, I promise you will sleep. Thanks for watching! If you liked the video please take a moment to like & subscribe! ? ❤️ ? EXCLUSIVE CONTENT (& links ) ? https://lunarexx.campsite.bio/ ? PAT

Dhiyanoiseasmr

Lottie K ASMR

Subs(7890) Views(160334)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Latex Glove Sounds & Hand Movements

Hi Everyone. I hope this video helps you relax and sleep well tonight :) ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) paypal.me/lottiekasmr Goodnight x #lottiekasmr

Dhiyanoiseasmr

ASMR Fixing you | Random Mechanic Roleplay

Hi Everyone. I hope this video helps you relax and sleep well tonight :) ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) https://www.paypal.com/paypalme/lottiekasmr Goo

Dhiyanoiseasmr

ASMR Photoshoot, doing your hair & make up

Hi Everyone. I hope this video helps you relax and sleep well tonight :) Sorry I'm a bit out of practice ? Social Media Instagram: https://www.instagram.com/lottiekasmr/ ? Support PayPal (Only if you feel the need to give back) https://www.paypa

Dhiyanoiseasmr

LightRoastASMR

Subs(2210) Views(202174)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - Digital Art + Commentary

Join me in procreate as I draw a canvas under the theme “Adversity” along with some Bible talk ramblings.

Dhiyanoiseasmr

ASMR - “The Lamb of God” Soft Spoken + digital art

I discuss the Bible what “the Lamb of God” means while a draw a relevant picture on my iPad via procreate.

Dhiyanoiseasmr

ASMR Bible Ramblings: The 7th Day

It has been way too long. Thanks for your patience. A video, rambling about the 7th day of creation and sketching on my iPad as I talk. God bless!

Dhiyanoiseasmr

Serene Splendor ASMR

Subs(3750) Views(655387)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Bible Reading: Ruth - Soft Spoken

I love how God shows us in the book of Ruth that, regardless of where we come from, we are still valued in His eyes. As a Moabite woman, Ruth probably wasn't the most obvious choice to carry the lineage of King David, yet through her loyalty to Naomi, we g

Dhiyanoiseasmr

ASMR: Pauanui Beach with chatting and prayer

I had a few days away with my family at Pauanui on the Coromandel this week. I hope you enjoy some of the scenery while we chat and pray.

Dhiyanoiseasmr

ASMR Bible Study - The Dying Thief (Soft Spoken)

If ever there was a bad time to ask for something...

Dhiyanoiseasmr

Czas Po Deszczu ASMR

Subs(29300) Views(8122185)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR PL | Bou Live #63 - Relaks z wyzwalaczami (szept)

Spis treści przygotowała Emilia :) 03:15 - Dźwięk dobry! 07:40 - waciki/kulki syntetyczne 09:40 - frotki pompony 12:04 - nylonowe rękawice 16:00 - pędzelki 18:08 - piłki z kolcami 23:52 - papierowy woreczek z ziarenkami 26:13 - gruszka do optyki :)

Dhiyanoiseasmr

ASMR PL | Bou zakłada słuchawki - czyli to co lubicie najbardziej :) (szept)

Dziękuję za pamięć i za wszystkie Wasze życzenia, które do tej pory otrzymałem. To bardzo miłe. Już chyba nie da się ukryć faktu, że dzisiaj Bou zaliczył 44 wiosnę :) Jest to chyba dobry moment, aby nagrać odcinek specjalny dla widzów - jed

Dhiyanoiseasmr

ASMR PL | Unravel szeptem #4 - Gdy zepsuje się samochód (gameplay, szept)

Każdy gdzieś... kiedyś... przeżył swoją pierwszą wyprawę pod namiot. Być może przydarzyło się też coś nieoczekiwanego lub co najmniej ciekawego. Dzisiaj zabieram Was na wędrówkę w nieznane. Specjalnie w tym odcinku podniosłem podkład mu

Dhiyanoiseasmr

Kali Cakes ASMR

Subs(1810) Views(106959)

Last Update (07/2021)

Dhiyanoiseasmr

FABLETICS ASMR TRY ON HAUL

Lots of crinkles and fabric scratching!! Check out my other socials: https://linktr.ee/kalicakesxo

Dhiyanoiseasmr

Random trigger ASMR

Lots of random triggers! Check out my other socials: https://linktr.ee/kalicakesxo

Dhiyanoiseasmr

Slime ASMR

Another new concept im trying! I liked some of the sounds i found so i will be making another video like this! Comment what you like/dont like Check out my other socials: https://Linktr.ee/kalicakesxo

Dhiyanoiseasmr

Creative Calm ASMR

Subs(356000) Views(92106062)

Last Update (07/2021)

Dhiyanoiseasmr

FAST & FURIOUS ASMR ? *super tingly fast triggers to make you tingle*

Welcome you! In this asmr fast and furious special, you'll enjoy a selection of fast trigger sounds to make you tingle! *combined with my super awkward rambles ofc* ➸New quietly entertaining content 3 times a week - every Tuesday, Thursday and Sunday. 1

Dhiyanoiseasmr

ASMR IN BED WITH YOU ? Bedtime Stories For Sleep

Welcome you! In this asmr in bed with you bedtime story reading video you'll enjoy some comforting personal attention, combined with story readings to help you fall asleep. ➸New quietly entertaining content 3 times a week - every Tuesday, Thursday and S

Dhiyanoiseasmr

ASMR Studying You VERY Closely | Personal Attention

Welcome you! In this asmr studying you very closely video, you'll enjoy lots of rather shy personal attention from your cute study buddy (who you may have seen before!). Enjoy lots of writing and sketching sounds! ➸New quietly entertaining content 3 tim

Dhiyanoiseasmr

Tiptap ASMR

Subs(3090) Views(272001)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Saying My Subscribers Names | Part 2

Hope you enjoy! Want to be involved in the QnA? Email your ASMR style video questions to: tiptapasmr@outlook.com Custom 10 minute videos for only £5! Click the link below and and leave a message with your video request, name and email address. Custom vi

Dhiyanoiseasmr

ASMR Come chat with us :) | Livestream!

Hope you enjoy! Want to be involved in the QnA? Email your ASMR style video questions to: tiptapasmr@outlook.com Custom 10 minute videos for only £5! Click the link below and and leave a message with your video request, name and email address. Custom vi

Dhiyanoiseasmr

ASMR £20 mic vs £120 mic?!

Hope you enjoy! Want to be involved in the QnA? Email your ASMR style video questions to: tiptapasmr@outlook.com Custom 10 minute videos for only £5! Click the link below and and leave a message with your video request, name and email address. Custom vi

Dhiyanoiseasmr

Sverigia

Subs(5090) Views(661067)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR - I miei cristalli?✨

Hej allihopa?? Con questo video vorrei inaugurare una rubrica in cui condividere con voi temi sui cristalli, mi sono avvicinata da poco a questo mondo vastissimo e che mi incuriosisce molto, sarebbe bello scoprire cose nuove insieme?✨ Buona visi

Dhiyanoiseasmr

ASMR - Quanto capisco lo svedese? ? *Daniele mi mette alla prova*

Hej allihopa?? Siamo arrivati alla fine di questo Midsommasmr, per me è stato un piacere e un onore farvi compagnia per 7 giorni, raccondandovi la Svezia tramite l’ASMR? spero sia stato un bel viaggio anche per voi! Vi saluto con questo video,

Dhiyanoiseasmr

ASMR - Lezione di Svedese? *roleplay*

Hej allihopa?? Oggi penultimo video del Midsommasmr e giorno ufficiale del Midsommar 2021? sono felicissima di pubblicare il mio video preferito in questa giornata speciale: un altro roleplay di una lezione di svedese (l’anno scorso vi era piaci

Dhiyanoiseasmr

ASMR Cap

Subs(3420) Views(246126)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Bloons TD 6 - Satisfying Balloon popping

Hi it's ASMR Cap from Germany. In the ASMR Bloons TD 6 - Satisfying Balloon popping Video I do play Bloons TD 6. I really love the sounds the balloons do when they are popping so I thought I should record some gameplay and upload it to my ASMR channel. Ti

Dhiyanoiseasmr

ASMR Rubbing Sounds on a Wooden Table (no talking)

Hi it's ASMR Cap from Germany. In the ASMR Rubbing Sounds on a Wooden Table (no talking) Video I'm rubbing my hands on a wooden table to create some awesome Sounds. Timestamps: You click the subscribe button ? Become a channel member and get exclusive

Dhiyanoiseasmr

MrBeast Rap Song

This is the MrBeast Rap Song. If you like MrBeast you will love this Rap Song about him and his friends Chris and Chandler. #mrbeast #mrbeastrap #rap

Dhiyanoiseasmr

Chrispy ASMR

Subs(31600) Views(3739983)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR JAPANESE MINI CANDY ICE CREAM CONES | Crunchy No Talking Satisfying Eating Sounds

Crunching on some Japanese snacks I have never tried before... STRAWBERRY - VANILLA - CHOCOLATE FLAVORED CANDY CONES! I found out that the LONG cones are made from the same company that makes POCKY ! (no wonder why they tasted so good) Some had double fla

Dhiyanoiseasmr

ASMR INTENSE STICKY SWEET LAYERED CAKE + COCONUT MOCHI | * No Talking Eating Sounds 먹방

WARNING : EXTREMELY STICKY SOUNDS ? ! WATCH FOR DETAILS! ? CHECK OUT MY OTHER VIDEOS ⬇️ https://www.youtube.com/playlist?list=PLwQRPBvs--54n-GomH591Ee0zMhfH3kEy Instagram - @ ChrispyASMR https://www.instagram.com/chrispyasmr/ Contact - ChrispyA

Dhiyanoiseasmr

ASMR STUFFED CHICKEN WINGS + PAN FRIED NOODLES MUKBANG | WHISPERED SATISFYING EATING SOUNDS 먹방

STUFFED CHICKEN WINGS! Removing the bones from raw chicken a mission. But the first bite, makes it all worth the while........until it's all gone. This is very Asian / Cambodian style stuffed wings. It's stuffed with MORE chicken mixed with Asian spices an

Dhiyanoiseasmr

Tina ASMR

Subs(735) Views(65448)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Lollipop Mouth Sounds ?

For business inquiries - tina.theasmrtist@gmail.com Instagram - https://www.instagram.com/tina__asmr/ Donations are not required but they are greatly appreciated and they will be used to upgrade my content & channel - https://paypal.me/tinatheasmrtist?lo

Dhiyanoiseasmr

Slightly toxic friend takes care of you after a crazy party *ASMR* // roleplay with gum chewing ??

For business inquiries - tina.theasmrtist@gmail.com Instagram - https://www.instagram.com/tina__asmr/ Donations are not required but they are greatly appreciated and they will be used to upgrade my content & channel - https://paypal.me/tinatheasmrtist?lo

Dhiyanoiseasmr

ASMR Chewing Gum & Brushing Your Face (No Talking) ?

For business inquiries - tina.theasmrtist@gmail.com Instagram - https://www.instagram.com/tina__asmr/ Donations are not required but they are greatly appreciated and they will be used to upgrade my content & channel - https://paypal.me/tinatheasmrtist?lo

Dhiyanoiseasmr

iL Asmr

Subs(137) Views(4923)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR HAIRCUT SCISSORS✂️ Personal Barber to Help You SLEEP | FASTEST | ROLEPLAY | RELAX

This#ASMR video involves Brushing Hair, Spraying Bottles sounds, Soft Spoken, Fast and aggressive Scissors Sounds, Fastest Haircut | Personal attention barber to help you SLEEP better. IF thiS ASMR video gives you *Tingles tingles*?entertainment. Let

Dhiyanoiseasmr

Unusual Sounds ASMR⚠️ SLEEP RELAXATION HAIRCUT✂️TINGLES TAPPING iL ASMR?

This #ASMR video has 3Type of Scissors Sounds, Unusual Sound(tape?), Tingles to help you SLEEP better. Please put on your headphone, and enjoy the best audio effect. (?????)? IF thiS ASMR video gives you *Tingles tingles*?en

Dhiyanoiseasmr

ASMR✂️FASTEST Personal Barber+HAIRCUT in One Minute = Scissors Relaxation iL ASMR

This #ASMR video is the Fastest ASMR ever roleplay barber giving you haircut in one minute. It has Scissors, Spraying bottles, Brushing Hair Sounds for Relaxation. Please put on your headphone, and enjoy the best audio effect. (?????)?

Dhiyanoiseasmr

ASMR YUN

Subs(16300) Views(1384169)

Last Update (07/2021)

Dhiyanoiseasmr

【ASMR】溫柔的心理咨詢師幫你舒緩壓力+輕語+觸發音|중국어 심리상담사 ㅣASMR psychological counseling

Instagram: http://www.instagram.com/kristinalove... WEIBO:李允儿辣么可爱 #ASMR​ #中文ASMR​ #ChineseASMR​ #중국어ASMR​ #relaxing​ #sleeping​ #RoleplayASMR

Dhiyanoiseasmr

【ASMR】雷雨天前女友來家借宿+溫柔輕語幫你掏耳朵|전여친 귀청소 해줄게요|Ear cleaning roleplay

Instagram: http://www.instagram.com/kristinaloverrr​ WEIBO:李允儿辣么可爱 #ASMR​ #中文ASMR​ #ChineseASMR​ #중국어ASMR​ #귀청소​ #EarCleaning​ #relaxing​ #sleeping​ #RoleplayASMR #RainstormSounds​ #천둥빗소리​

Dhiyanoiseasmr

【ASMR】溫柔的牙醫姐姐幫你治療壞掉的牙齒? 치과의사 상황극| Dental treatment Roleplay

Instagram: http://www.instagram.com/kristinaloverrr​ WEIBO:李允儿辣么可爱 #ASMR​ #中文ASMR​ #ChineseASMR​ #중국어ASMR​ #relaxing​ #sleeping​ #RoleplayASMR

Dhiyanoiseasmr

Perla ASMR

Subs(2920) Views(207179)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Legging scratching

Hello everyone ?, I had to edit this video more than usual due to background noises, I’m sorry. Let me know if you have any suggested videos! Email me Perlaaasmr@gmail.com for your specific request on a custom video. Thank you for your support. I

Dhiyanoiseasmr

ASMR Tapping on sneakers and wood sounds (ramble)

Hello everyone ? I hope you enjoy this random video. Email me Perlaaasmr@gmail.com for your specific request on a custom video. Thank you for your support. I truly appreciate you. ?

Dhiyanoiseasmr

ASMR Sketching you

Hello everyone! This is a custom video ? This is my first time doing a role play kinda video so I was a little nervous. Nevertheless, I hope you enjoy ? Email me Perlaaasmr@gmail.com for your specific request on a custom video. Thank you for your

Dhiyanoiseasmr

Mewlies ASMR

Subs(15900) Views(1496262)

Last Update (07/2021)

Dhiyanoiseasmr

(ASMR) Gentle Visuals for Sleep ♡ Long Nails Lens Scratching

Hey Sleepyhead! ? I've gotten a lot of requests for visual tingles, I'm going to incorporate them more often! ? Like and loop for more of this trigger! ? Subscribe for more tingly videos ? Join me on my other media!? Become part of the Fame

Dhiyanoiseasmr

(ASMR) ♡ Ear Licking & Brain Scratching Tingles

Hey Sleepyheads ? Thanks for for 15k subs! Your special earlicking tingles, but now with brain melting scratches! ?? Like and loop for more of this trigger! ? Subscribe for more tingly videos ? Join me on my other media! ? Become part of

Dhiyanoiseasmr

(ASMR) Placing Kisses on You ♡ Soft ♡ Sensitive Mouth Sounds

Hey Sleepyheads ? Do you like up close ear kisses and tingly mouth sounds? ? Like and loop for more of these triggers! Subscribe for more tingly videos ? Join me on my other media! ? Become part of the Famewlie on TWITCH: https://www.twitch.t

Dhiyanoiseasmr

River ASMR

Subs(58100) Views(7241891)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR ⛵Captain Takes Care Of You

? Go to https://surfshark.deals/RIVER enter promo code RIVER for 83% off and get 3 months totally free. Trigger Menu 00:00 Surfshark tingles prelude 01:07 show begins 02:00 serves liquid refreshment 03:55 magnifying glass 04:30 tending to graze 05:05 w

Dhiyanoiseasmr

ASMR Skincare Beautician Treatment [Cleanse, Face Scrub, Cream, Massage]

Use the code RIVER to get 25% off - see pinned comment! 00:00 Beauty Consultant Overview 03:30 Inspection 04:30 Creamy Charcoal Cleanser with Chamomile Extract 06:00 Sample Slice 06:40 Apply Cleanser 11:35 Facial Scrub with Eucalyptus 14:15 Sample Slice 1

Dhiyanoiseasmr

Best Budget Selfie Light 2021? Enhance your Beauty!? TONOR TRL-20 12'' Ring Light with Tripod Stand

UK ?? https://amzn.to/2QPQ1S5 (10% discount code: RiverTonor) US ?? https://amzn.to/37AQygl (20% discount code : Ringlight2) ? Tonor Website: https://www.tonormic.com/collections/ring-light For transparency, please note that I've never us

Dhiyanoiseasmr

asmr_byluisa

Subs(1870) Views(103299)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Tuning Fork or Singing Bowl? ^.^ Brain Vibrations

Hi! My name is Luisa. Welcome to my world! ^.^ My heart and mind are complete living in art and culture [ASMR included] ^.^ _____________ Find me on: My website | https://asmrbyluisa.com Twitch | https://www.twitch.tv/luisadpatricio Instagram | https://www

Dhiyanoiseasmr

ASMR | Pop Rocks * Relaxing Sounds Before Sleep

Hi! My name is Luisa. Welcome to my world! ^.^ My heart and mind are complete living in art and culture [ASMR included] ^.^ _____________ Find me on: My website | https://asmrbyluisa.com Twitch | https://www.twitch.tv/luisadpatricio Instagram | https://www

Dhiyanoiseasmr

ASMR | Follow/Not follow the Light * Making you Fall Asleep

Hi! My name is Luisa. Welcome to my world! ^.^ My heart and mind are complete living in art and culture [ASMR included] ^.^ _____________ Find me on: My website | https://asmrbyluisa.com Twitch | https://www.twitch.tv/luisadpatricio Instagram | https://www

Dhiyanoiseasmr

DireHit ASMR

Subs(121000) Views(16545803)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Doctor Cranial Nerve Exam Male Roleplay For Sleep & Anxiety (Ear Eye Exam Hearing Test Light)

ASMR Doctor Cranial Nerve Exam Male Roleplay For Sleep & Anxiety (Ear Eye Exam Hearing Test Light). I will examine the 12 cranial nerves with examinations for your medical procedure. Your Asmr exam rp will include hearing test, realistic exam, questions, N

Dhiyanoiseasmr

ASMR Fast & Aggressive Doctor Cranial Nerve Exam #shorts Roleplay

ASMR Fast & Aggressive Doctor Cranial Nerve Exam #shorts Roleplay. You just came in the doctor express line for your cranial nerve exam because you don't have much time. here we go Full Length Relaxing Cranial Nerve Exam: https://youtu.be/gMWGH47fYak If

Dhiyanoiseasmr

ASMR Realistic Haircut & Shave Barbershop Roleplay For Men (Clipper, Spray Bottle & Layered Sounds)

ASMR Realistic Haircut & Shave Barbershop Roleplay For Men (Clipper, Spray Bottle & Layered Sounds). Trim, Scissors, Razor, Face Touching Personal Attention Hair Care Beard Clean up. Today you guys are all male and you need a haircut because you haven't go

Dhiyanoiseasmr

Aesthetic Tingles ASMR

Subs(615) Views(20831)

Last Update (07/2021)

Dhiyanoiseasmr

POV: I clean & wash your face ??

??aesthetic tingles’s smoothie stand has just opened ?? ??‍♀️ Aloha! ? This is aesthetic tingles's smoothie stand! Would you like to purchase a smoothie? please make yourself at home! And take a look around while we prep ?

Dhiyanoiseasmr

{ASMR} Lofi Personal Attention ??‍♀️?✨ (Layered sounds)

??aesthetic tingles’s smoothie stand has just opened ?? ??‍♀️ Aloha! ? This is aesthetic tingles's smoothie stand! Would you like to purchase a smoothie? please make yourself at home! And take a look around while we prep ?

Dhiyanoiseasmr

{ASMR} Sour Patch Eating ???

??aesthetic tingles’s smoothie stand has just opened ?? ??‍♀️ Aloha! ? This is aesthetic tingles's smoothie stand! Would you like to purchase a smoothie? please make yourself at home! And take a look around while we prep ?

Dhiyanoiseasmr

Latte ASMR

Subs(1590000) Views(376606324)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Ear, Nose & Throat Examination

Hi everyone! It's Latte :) In this video, I will examine your ear, nose and throat. I hope you enjoy and have a relaxing time♥ P.S. 16:45 you don’t have any ‘fever’ sorry for my mistake! ☺️ Thank you for your support♥ : https://www.patreon.

Dhiyanoiseasmr

Relaxing Face Touching & Whispers For Your Sleep⭐️ ASMR

Hi everyone! It's Latte :) In this video, I will touch your face for your good night sleep! I hope you relax and Thank you so much for watching♥ Thank you for your support♥ : https://www.patreon.com/latteasmr

Dhiyanoiseasmr

ASMR Tingly False Eyelash Shop

Hi everyone! It's Latte :) In this video, I will show you some of false lashes and you will try them on. I hope enjoy it! Thank you so much for watching and have a nice day♥ Thank you for your support♥ : https://www.patreon.com/latteasmr

Dhiyanoiseasmr

Yeka ASMR

Subs(1100) Views(49915)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR TU AMIGA ANTIPATICA SE ENAMORA DE TU NOVIO?LE CONFIESA SU AMOR?LA AMIGA DE TU NOVIA TE COQUETEA

ASMR TU AMIGA ANTIPATICA SE ENAMORA DE TU NOVIO?LE CONFIESA SU AMOR?LA AMIGA DE TU NOVIA TE COQUETEA Hola, bienvenido o bienvenida a mi canal de #ASMR ❤️ ✋ te traigo un #ASMR #ROLEPLAY #AMIGAANTIPATICA. Espero que te guste, si es así déjate

Dhiyanoiseasmr

ASMR UÑAS POSTIZAS EXTRA LARGAS| TAPPING SOUNDS For Sleep/Relaxation ♡ (Long Nails & Whispering)

#ASMRUÑASPOSTIZAS #ASMRespañol #asmrUÑAS ASMR UÑAS POSTIZAS EXTRA LARGAS| TAPPING SOUNDS For Sleep/Relaxation ♡ (Long Nails & Whispering) Espero disfruten mucho este ASMR es para ustedes con mucho amor Déjame tu comentario abajo, te leo. Sigue

Dhiyanoiseasmr

ASMR ELIMINANDO ENERGIA NEGATIVA

#ASMRlimpiezaenergética #ASMRenespañol ASMR ELIMINANDO ENERGÍA NEGATIVA Hoy te traigo un nuevo ASMR para eliminar tu energía negativa y que puedas dormir mejor. ❤️ Déjame tu comentario abajo, te leo. Sigueme en mis Redes Sociales *Tik-Tok http

Dhiyanoiseasmr

ASMR KALI

Subs(540000) Views(147548613)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR | Médecin des arrivées extra-terrestres ! ?

Après la découverte des voyages dans l'espace, l'humain a découvert d'autres espèces vivantes… Ainsi, après des millénaires déchanges et de découvertes avec ces derniers, les voyages intergalactiques sont mis en place. Les habitants de chaque pla

Dhiyanoiseasmr

ASMR | Je te maquille ♡ Attention personnelle ~ avec la palette Otrera de @Sananas

Coucou toi ♡ Ce soir je m'occupe de ton maquillage. J'ai acheté la nouvelle palette d'otrera beauty de Sanas et j'aimerais l'essayer sur toi ! T'es mon cobaye tu sais que je suis pas douée alors je tente des trucs sur toi aha Merci de me prêter ton vi

Dhiyanoiseasmr

ASMR | Je m’occupe de tes cheveux { soin, brossage, massage… } layered sounds

Coucou toi ! Ce soir je m’occupe de ta tête. Massage crânien, soins, huiles, brossage, peignage … ? le tout en layered sound ! (Sons ajoutés) bonne détente ! ——PARTENAIRE Avec le code KALI, vous pouvez bénéficier d'une réduction CUMULABL

Dhiyanoiseasmr

adrimarie ASMR

Subs(414) Views(22993)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR Starbucks Haul

Hello! I am back :) Thanks everyone for being so patient. I am lucky to have such dedicated viewers like you so soon into starting my channel. I work full time and also go to university full time so it has been hard for me to make new content this past m

Dhiyanoiseasmr

ASMR Relaxing Fast Typing (no talking)

Hello! In this video I am helping you relax as you watch me type - for tingles, study, work, or sleep. Please let me know if you liked it by dropping a comment below. Thanks!

Dhiyanoiseasmr

ASMR - Follow the Light(s)!

Hello! In this video I am trying out one of my personal favorite triggers - follow the light. I have some flashlights/glowsticks and all you have to do is follow them with your eyes and feel relaxed. Thank you for watching!

Dhiyanoiseasmr

Unyu ASMR 우뉴

Subs(301) Views(15597)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR no talking simple makeup 노토킹 간단 메이크업 후시녹음 簡単メイク

Dhiyanoiseasmr

ASMR 106 triggers in 3:30!106가지 트리거 3:30で高速106トリガー

재미로 보셔욤 #100triggers

Dhiyanoiseasmr

ASMR Relaxing body oil massage?‍♀️ 촉촉한 바디 오일 마사지 롤플 オイルたっぷり!優しくマッサ?

오늘은 오일 소리를 듬뿍 담아보았습니댜

Dhiyanoiseasmr

Johnn ASMR

Subs(19500) Views(1435205)

Last Update (07/2021)

Dhiyanoiseasmr

ASMR SLEEP CLINIC ROLEPLAY (FULL EXAMINATION)

ASMR SLEEP CLINIC ROLEPLAY (FULL EXAMINATION) FOLLOW ME ON INSTAGRAM TO STAY CONNECTED: https://www.instagram.com/frjohnn/​​​​ FOLLOW ME ON TWITCH FOR EVERYDAY LIVE STREAMS : https://www.twitch.tv/johnnasmr JOIN THE ASMR COMMUNITY DISCORD HERE:

Dhiyanoiseasmr

ASMR EXAMEN DE NERVIOS CRANEALES RÁPIDO EN 1 MINUTO | ASMR EN ESPAÑOL

¿ESTÁ LISTO PARA SU REVISIÓN? ASMR RÁPIDO EXAMEN DE NERVIOS CRANEALES EN 1 MINUTO | ASMR EN ESPAÑOL ¡USTEDES SON LA MEJOR Y MÁS COMUNIDAD DE APOYO! Estoy contento de poder ayudar a todos a dormir y sentir asmr :) SÍGUEME EN INSTAGRAM PARA MANTEN

Dhiyanoiseasmr

ASMR | MY SUBSCRIBERS PICK THE TRIGGER (AIR TRACING, INAUDIBLE WHISPERS, HAND MOVEMENTS)

ASMR DOING YOUR FAV TRIGGERS (AIR TRACING, INAUDIBLE WHISPERS, HAND MOVEMENTS) Timestamp: 0:00 - INTRO (CATCHING UP WITH YOU ALL) 2:07 - AIR TRACING TRIGGER 5:30 - INAUDIBLE WHISPERING 7:15 - FOLLOW THE LIGHT TRIGGER 8:58 - WRITING SOUNDS (PENCIL) 11:10 -